Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02151
Secondary Accession Numbers
  • 7634
Name fMet-Leu-Phe receptor
Synonyms
  1. FPR
  2. N-formyl peptide receptor
  3. N-formylpeptide chemoattractant receptor
  4. fMLP receptor
Gene Name FPR1
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function High affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
n-formyl peptide receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.4
SNPs FPR1
Gene Sequence
>1053 bp
ATGGAGACAAATTCCTCTCTCCCCACGAACATCTCTGGAGGGACACCTGCTGTATCTGCT
GGCTATCTCTTCCTGGATATCATCACTTATCTGGTATTTGCAGTCACCTTTGTCCTCGGG
GTCCTGGGCAACGGGCTTGTGATCTGGGTGGCTGGATTCCGGATGACACACACAGTCACC
ACCATCAGTTACCTGAACCTGGCCGTGGCTGACTTCTGTTTCACCTCCACTTTGCCATTC
TTCATGGTCAGGAAGGCCATGGGAGGACATTGGCCTTTCGGCTGGTTCCTGTGCAAATTC
GTCTTTACCATAGTGGACATCAACTTGTTCGGAAGTGTCTTCCTGATCGCCCTCATTGCT
CTGGACCGCTGTGTTTGCGTCCTGCATCCAGTCTGGACCCAGAACCACCGCACCGTGAGC
CTGGCCAAGAAGGTGATCATTGGGCCCTGGGTGATGGCTCTGCTCCTCACATTGCCAGTT
ATCATTCGTGTGACTACAGTACCTGGTAAAACGGGGACAGTAGCCTGCACTTTTAACTTT
TCGCCCTGGACCAACGACCCTAAAGAGAGGATAAATGTGGCCGTTGCCATGTTGACGGTG
AGAGGCATCATCCGGTTCATCATTGGCTTCAGCGCACCCATGTCCATCGTTGCTGTCAGT
TATGGGCTTATTGCCACCAAGATCCACAAGCAAGGCTTGATTAAGTCCAGTCGTCCCTTA
CGGGTCCTCTCCTTTGTCGCAGCAGCCTTTTTTCTCTGCTGGTCCCCATATCAGGTGGTG
GCCCTTATAGCCACAGTCAGAATCCGTGAGTTATTGCAAGGCATGTACAAAGAAATTGGT
ATTGCAGTGGATGTGACAAGTGCCCTGGCCTTCTTCAACAGCTGCCTCAACCCCATGCTC
TATGTCTTCATGGGCCAGGACTTCCGGGAGAGGCTGATCCACGCCCTTCCCGCCAGTCTG
GAGAGGGCCCTGACCGAGGACTCAACCCAAACCAGTGACACAGCTACCAATTCTACTTTA
CCTTCTGCAGAGGTGGAGTTACAGGCAAAGTGA
Protein Properties
Number of Residues 350
Molecular Weight 38445.1
Theoretical pI 9.26
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 28-50
  • 62-83
  • 101-121
  • 141-162
  • 206-226
  • 243-266
  • 286-305
Protein Sequence
>fMet-Leu-Phe receptor
METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
GenBank ID Protein 9454516
UniProtKB/Swiss-Prot ID P21462
UniProtKB/Swiss-Prot Entry Name FPR1_HUMAN
PDB IDs Not Available
GenBank Gene ID AC018755
GeneCard ID FPR1
GenAtlas ID FPR1
HGNC ID HGNC:3826
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Boulay F, Tardif M, Brouchon L, Vignais P: Synthesis and use of a novel N-formyl peptide derivative to isolate a human N-formyl peptide receptor cDNA. Biochem Biophys Res Commun. 1990 May 16;168(3):1103-9. [PubMed:2161213 ]
  4. Boulay F, Tardif M, Brouchon L, Vignais P: The human N-formylpeptide receptor. Characterization of two cDNA isolates and evidence for a new subfamily of G-protein-coupled receptors. Biochemistry. 1990 Dec 18;29(50):11123-33. [PubMed:2176894 ]
  5. Murphy PM, McDermott D: Functional expression of the human formyl peptide receptor in Xenopus oocytes requires a complementary human factor. J Biol Chem. 1991 Jul 5;266(19):12560-7. [PubMed:1712023 ]
  6. Bao L, Gerard NP, Eddy RL Jr, Shows TB, Gerard C: Mapping of genes for the human C5a receptor (C5AR), human FMLP receptor (FPR), and two FMLP receptor homologue orphan receptors (FPRH1, FPRH2) to chromosome 19. Genomics. 1992 Jun;13(2):437-40. [PubMed:1612600 ]
  7. Murphy PM, Tiffany HL, McDermott D, Ahuja SK: Sequence and organization of the human N-formyl peptide receptor-encoding gene. Gene. 1993 Nov 15;133(2):285-90. [PubMed:8224916 ]
  8. Perez HD, Holmes R, Kelly E, McClary J, Chou Q, Andrews WH: Cloning of the gene coding for a human receptor for formyl peptides. Characterization of a promoter region and evidence for polymorphic expression. Biochemistry. 1992 Nov 24;31(46):11595-9. [PubMed:1445895 ]
  9. Maestes DC, Potter RM, Prossnitz ER: Differential phosphorylation paradigms dictate desensitization and internalization of the N-formyl peptide receptor. J Biol Chem. 1999 Oct 15;274(42):29791-5. [PubMed:10514456 ]