You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02180
Secondary Accession Numbers
  • 7665
Name Metabotropic glutamate receptor 5
Synonyms
  1. mGluR5
Gene Name GRM5
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor activity
Specific Function Receptor for glutamate. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol- calcium second messenger system and generates a calcium-activated chloride current
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 11q14.3
SNPs GRM5
Gene Sequence
>3639 bp
ATGGTCCTTCTGTTGATCCTGTCAGTCTTACTTTTGAAAGAAGATGTCCGTGGGAGTGCA
CAGTCCAGTGAGAGGAGGGTGGTGGCTCACATGCCGGGTGACATCATTATTGGAGCTCTC
TTTTCTGTTCATCACCAGCCTACTGTGGACAAAGTTCATGAGAGGAAGTGTGGGGCGGTC
CGTGAACAGTATGGCATTCAGAGAGTGGAGGCCATGCTGCATACCCTGGAAAGGATCAAT
TCAGACCCCACACTCTTGCCCAACATCACACTGGGCTGTGAGATAAGGGACTCCTGCTGG
CATTCGGCTGTGGCCCTAGAGCAGAGCATTGAGTTCATAAGAGATTCCCTCATTTCTTCA
GAAGAGGAAGAAGGCTTGGTACGCTGTGTGGATGGCTCCTCCTCTTCCTTCCGCTCCAAG
AAGCCCATAGTAGGGGTCATTGGGCCTGGCTCCAGTTCTGTAGCCATTCAGGTCCAGAAT
TTGCTCCAGCTTTTCAACATACCTCAGATTGCTTACTCAGCAACCAGCATGGATCTGAGT
GACAAGACTCTGTTCAAATATTTCATGAGGGTTGTGCCTTCAGATGCTCAGCAGGCAAGG
GCCATGGTGGACATAGTGAAGAGGTACAACTGGACCTATGTATCAGCCGTGCACACAGAA
GGCAACTATGGAGAAAGTGGGATGGAAGCCTTCAAAGATATGTCAGCGAAGGAAGGGATT
TGCATCGCCCACTCTTACAAAATCTACAGTAATGCAGGGGAGCAGAGCTTTGATAAGCTG
CTGAAGAAGCTCACAAGTCACTTGCCCAAGGCCCGGGTGGTGGCCTGCTTCTGTGAGGGC
ATGACGGTGAGAGGTCTGCTGATGGCCATGAGGCGCCTGGGTCTAGCGGGAGAATTTCTG
CTTCTGGGCAGTGATGGCTGGGCTGACAGGTATGATGTGACAGATGGATATCAGCGAGAA
GCTGTTGGTGGCATCACAATCAAGCTCCAATCTCCCGATGTCAAGTGGTTTGATGATTAT
TATCTGAAGCTCCGGCCAGAAACAAACCACCGAAACCCTTGGTTTCAAGAATTTTGGCAG
CATCGTTTTCAGTGCCGACTGGAAGGGTTTCCACAGGAGAACAGCAAATACAACAAGACT
TGCAATAGTTCTCTGACTCTGAAAACACATCATGTTCAGGATTCCAAAATGGGATTTGTG
ATCAACGCCATCTATTCGATGGCCTATGGGCTCCACAACATGCAGATGTCCCTCTGCCCA
GGCTATGCAGGACTCTGTGATGCCATGAAGCCAATTGATGGACGGAAACTTTTGGAGTCC
CTGATGAAAACCAATTTTACTGGGGTTTCTGGAGATACGATCCTATTCGATGAGAATGGA
GACTCTCCAGGAAGGTATGAAATAATGAATTTCAAGGAAATGGGAAAAGATTACTTTGAT
TATATCAACGTTGGAAGTTGGGACAATGGAGAATTAAAAATGGATGATGATGAAGTATGG
TCCAAGAAAAGCAACATCATCAGATCTGTGTGCAGTGAACCATGTGAGAAAGGCCAGATC
AAGGTGATCCGAAAGGGAGAAGTCAGCTGTTGTTGGACCTGTACACCTTGTAAGGAGAAT
GAGTATGTCTTTGATGAGTACACATGCAAGGCATGCCAACTGGGGTCTTGGCCCACTGAT
GATCTCACAGGTTGTGACTTGATCCCAGTACAGTATCTTCGATGGGGTGACCCTGAACCC
ATTGCAGCTGTGGTGTTTGCCTGCCTTGGCCTCCTGGCCACCCTGTTTGTTACTGTAGTC
TTCATCATTTACCGTGATACACCAGTAGTCAAGTCCTCAAGCAGGGAACTCTGCTACATT
ATCCTTGCTGGCATCTGCCTGGGCTACTTATGTACCTTCTGCCTCATTGCGAAGCCCAAA
CAGATTTACTGCTACCTTCAGAGAATTGGCATTGGTCTCTCCCCAGCCATGAGCTACTCA
GCCCTTGTAACAAAGACCAACCGTATTGCAAGGATCCTGGCTGGCAGCAAGAAGAAGATC
TGTACCAAAAAGCCCAGATTCATGAGTGCCTGTGCCCAGCTAGTGATTGCTTTCATTCTC
ATATGCATCCAGTTGGGCATCATCGTTGCCCTCTTTATAATGGAGCCTCCTGACATAATG
CATGACTACCCAAGCATTCGAGAAGTCTACCTGATCTGTAACACCACCAACCTAGGAGTT
GTCACTCCACTTGGATACAATGGATTGTTGATTTTGAGCTGCACCTTCTATGCGTTCAAG
ACCAGAAATGTTCCAGCTAACTTCAACGAGGCCAAGTATATCGCCTTCACAATGTACACG
ACCTGCATTATATGGCTAGCTTTTGTGCCAATCTACTTTGGCAGCAACTACAAAATCATC
ACCATGTGTTTCTCGGTCAGCCTCAGTGCCACAGTGGCCCTAGGCTGCATGTTTGTGCCG
AAGGTGTACATCATCCTGGCCAAACCAGAGAGAAACGTGCGCAGCGCCTTCACCACATCT
ACCGTGGTGCGCATGCATGTAGGGGATGGCAAGTCATCCTCCGCAGCCAGCAGATCCAGC
AGCCTAGTCAACCTGTGGAAGAGAAGGGGCTCCTCTGGGGAAACCTTAAGGTACAAAGAC
AGGAGACTGGCCCAGCACAAGTCGGAAATAGAGTGTTTCACCCCCAAAGGGAGTATGGGG
AATGGTGGGAGAGCAACAATGAGCAGTTCCAATGGAAAATCCGTCACGTGGGCCCAGAAT
GAGAAGAGCAGCCGGGGGCAGCACCTGTGGCAGCGCCTGTCCATCCACATCAACAAGAAA
GAAAACCCCAACCAAACGGCCGTCATCAAGCCCTTCCCCAAGAGCACGGAGAGCCGTGGC
CTGGGCGCTGGCGCTGGCGCAGGCGGGAGCGCTGGGGGCGTGGGGGCCACGGGCGGTGCG
GGCTGCGCAGGCGCCGGCCCAGGCGGGCCCGAGTCCCCAGACGCCGGCCCCAAGGCGCTG
TATGATGTGGCCGAGGCTGAGGAGCACTTCCCGGCGCCCGCGCGGCCGCGCTCACCGTCG
CCCATCAGCACGCTGAGCCACCGCGCGGGCTCGGCCAGCCGCACGGACGACGATGTGCCG
TCGCTGCACTCGGAGCCTGTGGCGCGCAGCAGCTCCTCGCAGGGCTCCCTCATGGAGCAG
ATCAGCAGTGTGGTCACCCGCTTCACGGCCAACATCAGCGAGCTCAACTCCATGATGCTG
TCCACCGCGGCCCCCAGCCCCGGCGTCGGCGCCCCGCTCTGCTCGTCCTACCTGATCCCC
AAAGAGATCCAGTTGCCCACGACCATGACGACCTTTGCCGAAATCCAGCCTCTGCCGGCC
ATCGAAGTCACGGGAGGCGCGCAGCCCGCGGCAGGGGCGCAGGCGGCTGGGGACGCGGCC
CGGGAGAGCCCCGCGGCCGGTCCCGAGGCTGCGGCCGCCAAGCCAGACCTGGAGGAGCTG
GTGGCTCTCACCCCGCCGTCCCCCTTCAGAGACTCGGTGGACTCGGGGAGCACAACCCCC
AACTCGCCAGTGTCCGAGTCGGCCCTCTGTATCCCGTCGTCTCCCAAATATGACACTCTT
ATCATAAGAGATTACACTCAGAGCTCCTCGTCGTTGTGA
Protein Properties
Number of Residues 1212
Molecular Weight 132467.6
Theoretical pI 7.82
Pfam Domain Function
Signals
  • 1-20
Transmembrane Regions
  • 580-602
  • 617-637
  • 649-667
  • 694-714
  • 738-759
  • 773-795
  • 802-827
Protein Sequence
>Metabotropic glutamate receptor 5
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQ
HRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG
NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGAGAGGSAGGVGATGGAGCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPS
PISTLSHRAGSASRTDDDVPSLHSEPVARSSSSQGSLMEQISSVVTRFTANISELNSMML
STAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAA
RESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL
IIRDYTQSSSSL
GenBank ID Protein 219842343
UniProtKB/Swiss-Prot ID P41594
UniProtKB/Swiss-Prot Entry Name GRM5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001143831.2
GeneCard ID GRM5
GenAtlas ID GRM5
HGNC ID HGNC:4597
References
General References
  1. Minakami R, Katsuki F, Yamamoto T, Nakamura K, Sugiyama H: Molecular cloning and the functional expression of two isoforms of human metabotropic glutamate receptor subtype 5. Biochem Biophys Res Commun. 1994 Mar 30;199(3):1136-43. [PubMed:7908515 ]
  2. Minakami R, Katsuki F, Sugiyama H: A variant of metabotropic glutamate receptor subtype 5: an evolutionally conserved insertion with no termination codon. Biochem Biophys Res Commun. 1993 Jul 30;194(2):622-7. [PubMed:7688218 ]