You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02190
Secondary Accession Numbers
  • 7675
  • HMDBP06020
Name Phosphatidylserine synthase 1
Synonyms
  1. PSS-1
  2. PtdSer synthase 1
  3. Serine-exchange enzyme I
Gene Name PTDSS1
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatidylserine biosynthetic process
Specific Function Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In membranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine.
Pathways
  • Glycerophospholipid metabolism
  • Phosphatidylethanolamine Biosynthesis
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/9M5)
  • phosphatidylserine biosynthesis
  • Phospholipid Biosynthesis
Reactions
L-1-phosphatidylethanolamine + L-Serine → L-1-phosphatidylserine + Ethanolamine details
GO Classification
Biological Process
phosphatidylserine biosynthetic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Molecular Function
transferase activity
Process
metabolic process
phosphatidylserine metabolic process
phosphatidylserine biosynthetic process
organophosphate metabolic process
phospholipid metabolic process
glycerophospholipid metabolic process
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 8
Locus 8q22
SNPs PTDSS1
Gene Sequence
>1422 bp
ATGGCGTCCTGCGTGGGGAGCCGGACCCTAAGCAAGGATGATGTGAACTACAAAATGCAT
TTCCGGATGATCAACGAGCAGCAAGTGGAGGACATCACCATTGACTTCTTCTACCGGCCG
CATACCATCACCCTGCTCAGCTTCACCATCGTCAGCCTCATGTACTTCGCCTTTACCAGG
GATGACTCTGTTCCAGAAGACAACATCTGGAGAGGCATCCTCTCTGTTATTTTCTTCTTT
CTTATCATCAGTGTGTTAGCTTTCCCCAATGGTCCGTTCACTCGACCTCATCCAGCCTTA
TGGCGAATGGTTTTTGGACTCAGTGTGCTCTACTTCCTGTTCCTGGTATTCCTACTCTTC
CTGAATTTCGAGCAGGTTAAATCTCTAATGTATTGGCTAGATCCAAATCTTCGATACGCC
ACAAGGGAAGCAGATGTCATGGAGTATGCTGTGAACTGCCATGTGATCACCTGGGAGAGG
ATTATCAGCCACTTTGATATTTTTGCATTTGGACATTTCTGGGGCTGGGCCATGAAGGCC
TTGCTGATCCGTAGTTACGGTCTCTGCTGGACAATCAGTATTACCTGGGAGCTGACTGAG
CTCTTCTTCATGCATCTCCTCCCCAATTTTGCCGAGTGCTGGTGGGATCAAGTCATTCTG
GACATCCTGTTGTGCAATGGCGGTGGCATTTGGCTGGGCATGGTCGTTTGCCGGTTTTTA
GAGATGAGGACTTACCACTGGGCAAGCTTCAAGGACATTCATACCACCACCGGGAAGATC
AAGAGAGCTGTTCTGCAGTTCACTCCTGCTAGCTGGACCTATGTTCGATGGTTTGACCCC
AAATCTTCTTTTCAGAGAGTAGCTGGAGTGTACCTTTTCATGATCATCTGGCAGCTGACT
GAGTTGAATACCTTCTTCTTGAAGCATATCTTTGTGTTCCAAGCCAGTCATCCATTAAGT
TGGGGTAGAATTCTCTTTATTGGTGGCATCACAGCTCCCACAGTGAGACAGTACTACGCT
TACCTCACCGACACACAGTGCAAGCGCGTAGGAACACAATGCTGGGTGTTTGGGGTCATT
GGTTTCCTGGAGGCCATTGTTTGCATAAAATTTGGACAAGATCTCTTCTCTAAGACCCAA
ATACTCTATGTTGTGCTTTGGCTTCTTTGCGTGGCTTTCACCACTTTCCTCTGTCTGTAC
GGCATGATTTGGTATGCAGAACACTATGGTCACCGAGAAAAGACCTACTCGGAGTGTGAA
GATGGCACCTACAGTCCAGAGATCTCCTGGCATCACAGGAAAGGGACAAAAGGTTCTGAA
GACAGCCCACCCAAGCATGCAGGCAACAACGAAAGCCATTCTTCCAGGAGAAGGAATCGG
CATTCCAAGTCAAAAGTCACCAATGGCGTTGGAAAGAAATGA
Protein Properties
Number of Residues 473
Molecular Weight 55527.18
Theoretical pI 8.421
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Phosphatidylserine synthase 1
MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTIVSLMYFAFTR
DDSVPEDNIWRGILSVIFFFLIISVLAFPNGPFTRPHPALWRMVFGLSVLYFLFLVFLLF
LNFEQVKSLMYWLDPNLRYATREADVMEYAVNCHVITWERIISHFDIFAFGHFWGWAMKA
LLIRSYGLCWTISITWELTELFFMHLLPNFAECWWDQVILDILLCNGGGIWLGMVVCRFL
EMRTYHWASFKDIHTTTGKIKRAVLQFTPASWTYVRWFDPKSSFQRVAGVYLFMIIWQLT
ELNTFFLKHIFVFQASHPLSWGRILFIGGITAPTVRQYYAYLTDTQCKRVGTQCWVFGVI
GFLEAIVCIKFGQDLFSKTQILYVVLWLLCVAFTTFLCLYGMIWYAEHYGHREKTYSECE
DGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P48651
UniProtKB/Swiss-Prot Entry Name PTSS1_HUMAN
PDB IDs Not Available
GenBank Gene ID D14694
GeneCard ID PTDSS1
GenAtlas ID PTDSS1
HGNC ID HGNC:9587
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  5. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  6. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  7. Nomura N, Miyajima N, Sazuka T, Tanaka A, Kawarabayasi Y, Sato S, Nagase T, Seki N, Ishikawa K, Tabata S: Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1. DNA Res. 1994;1(1):27-35. [PubMed:7584026 ]