You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02198
Secondary Accession Numbers
  • 7683
Name Beta-2-microglobulin precursor [Contains: Beta-2-microglobulin variant pI 5.3]
Synonyms Not Available
Gene Name B2M
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Beta-2-microglobulin is the beta-chain of major histocompatibility complex class I molecules
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:15
Locus 15q21-q22.2
SNPs B2M
Gene Sequence
>360 bp
ATGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCTACTCTCTCTTTCTGGCCTGGAGGGC
ATCCAGCGTACTCCAAAGATTCAGGTTTACTCACGTCATCCAGCAGAGAATGGAAAGTCA
AATTTCCTGAATTGCTATGTGTCTGGGTTTCATCAATCCGACATTGAAGTTGACTTACTG
AAGAATGGAGAGAGAATTGAAAAAGTGGAGCATTCAGACTTGTCTTTCAGCAAGGACTGG
TCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTGAAAAAGATGAGTATGCCTGC
CGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGATCGAGACATGTAA
Protein Properties
Number of Residues 119
Molecular Weight 13715.0
Theoretical pI 6.51
Pfam Domain Function
Signals
  • 1-20
Transmembrane Regions Not Available
Protein Sequence
>Beta-2-microglobulin precursor [Contains: Beta-2-microglobulin variant pI 5.3]
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
GenBank ID Protein 179318
UniProtKB/Swiss-Prot ID P61769
UniProtKB/Swiss-Prot Entry Name B2MG_HUMAN
PDB IDs
GenBank Gene ID M17987
GeneCard ID B2M
GenAtlas ID B2M
HGNC ID HGNC:914
References
General References
  1. Gussow D, Rein R, Ginjaar I, Hochstenbach F, Seemann G, Kottman A, Ploegh HL: The human beta 2-microglobulin gene. Primary structure and definition of the transcriptional unit. J Immunol. 1987 Nov 1;139(9):3132-8. [PubMed:3312414 ]
  2. Suggs SV, Wallace RB, Hirose T, Kawashima EH, Itakura K: Use of synthetic oligonucleotides as hybridization probes: isolation of cloned cDNA sequences for human beta 2-microglobulin. Proc Natl Acad Sci U S A. 1981 Nov;78(11):6613-7. [PubMed:6171820 ]
  3. Cunningham BA, Wang JL, Berggard I, Peterson PA: The complete amino acid sequence of beta 2-microglobulin. Biochemistry. 1973 Nov 20;12(24):4811-22. [PubMed:4586824 ]
  4. Momoi T, Suzuki M, Titani K, Hisanaga S, Ogawa H, Saito A: Amino acid sequence of a modified beta 2-microglobulin in renal failure patient urine and long-term dialysis patient blood. Clin Chim Acta. 1995 May 15;236(2):135-44. [PubMed:7554280 ]
  5. Bjorkman PJ, Saper MA, Samraoui B, Bennett WS, Strominger JL, Wiley DC: Structure of the human class I histocompatibility antigen, HLA-A2. Nature. 1987 Oct 8-14;329(6139):506-12. [PubMed:3309677 ]
  6. Saper MA, Bjorkman PJ, Wiley DC: Refined structure of the human histocompatibility antigen HLA-A2 at 2.6 A resolution. J Mol Biol. 1991 May 20;219(2):277-319. [PubMed:2038058 ]
  7. Collins EJ, Garboczi DN, Karpusas MN, Wiley DC: The three-dimensional structure of a class I major histocompatibility complex molecule missing the alpha 3 domain of the heavy chain. Proc Natl Acad Sci U S A. 1995 Feb 14;92(4):1218-21. [PubMed:7862664 ]
  8. Smith KJ, Reid SW, Harlos K, McMichael AJ, Stuart DI, Bell JI, Jones EY: Bound water structure and polymorphic amino acids act together to allow the binding of different peptides to MHC class I HLA-B53. Immunity. 1996 Mar;4(3):215-28. [PubMed:8624812 ]
  9. Okon M, Bray P, Vucelic D: 1H NMR assignments and secondary structure of human beta 2-microglobulin in solution. Biochemistry. 1992 Sep 22;31(37):8906-15. [PubMed:1390678 ]