You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02220
Secondary Accession Numbers
  • 7705
Name Voltage-dependent L-type calcium channel subunit alpha-1C
Synonyms
  1. Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle
  2. Voltage-gated calcium channel subunit alpha Cav1.2
Gene Name CACNA1C
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1C gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin- GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA). Calcium channels containing the alpha-1C subunit play an important role in excitation-contraction coupling in the heart. The various isoforms display marked differences in the sensitivity to DHP compounds. Binding of calmodulin or CABP1 at the same regulatory sites results in an opposit effects on the channel function
Pathways
  • Acebutolol Action Pathway
  • Alprenolol Action Pathway
  • Amiodarone Action Pathway
  • Amlodipine Action Pathway
  • Arbutamine Action Pathway
  • Atenolol Action Pathway
  • Betaxolol Action Pathway
  • Bevantolol Action Pathway
  • Bisoprolol Action Pathway
  • Bopindolol Action Pathway
  • Bupranolol Action Pathway
  • Carteolol Action Pathway
  • Carvedilol Action Pathway
  • Diltiazem Action Pathway
  • Disopyramide Action Pathway
  • Dobutamine Action Pathway
  • Epinephrine Action Pathway
  • Esmolol Action Pathway
  • Felodipine Action Pathway
  • Felodipine Metabolism Pathway
  • Flecainide Action Pathway
  • Fosphenytoin (Antiarrhythmic) Action Pathway
  • Ibutilide Action Pathway
  • Isoprenaline Action Pathway
  • Isradipine Action Pathway
  • Labetalol Action Pathway
  • Levobunolol Action Pathway
  • Lidocaine (Antiarrhythmic) Action Pathway
  • Metipranolol Action Pathway
  • Metoprolol Action Pathway
  • Mexiletine Action Pathway
  • Muscle/Heart Contraction
  • Nadolol Action Pathway
  • Nebivolol Action Pathway
  • Nifedipine Action Pathway
  • Nimodipine Action Pathway
  • Nisoldipine Action Pathway
  • Nitrendipine Action Pathway
  • Oxprenolol Action Pathway
  • Penbutolol Action Pathway
  • Phenytoin (Antiarrhythmic) Action Pathway
  • Pindolol Action Pathway
  • Practolol Action Pathway
  • Procainamide (Antiarrhythmic) Action Pathway
  • Propranolol Action Pathway
  • Quinidine Action Pathway
  • Sotalol Action Pathway
  • Timolol Action Pathway
  • Tocainide Action Pathway
  • Verapamil Action Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
ion channel complex
cation channel complex
macromolecular complex
intrinsic to membrane
protein complex
integral to membrane
calcium channel complex
voltage-gated calcium channel complex
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
voltage-gated calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
transmembrane transport
ion transport
cation transport
Cellular Location
  1. Cell membrane
  2. Membrane
  3. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 12p13.3
SNPs CACNA1C
Gene Sequence
>6666 bp
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGGTTCCAACTAT
GGGAGCCCACGCCCCGCCCATGCCAACATGAATGCCAATGCGGCAGCGGGGCTGGCCCCT
GAGCACATCCCCACCCCGGGGGCTGCCCTGTCGTGGCAGGCGGCCATCGACGCAGCCCGG
CAGGCTAAGCTGATGGGCAGCGCTGGCAATGCGACCATCTCCACAGTCAGCTCCACGCAG
CGGAAGCGGCAGCAATATGGGAAACCCAAGAAGCAGGGCAGCACCACGGCCACACGCCCG
CCCCGAGCCCTGCTCTGCCTGACCCTGAAGAACCCCATCCGGAGGGCCTGCATCAGCATT
GTCGAATGGAAACCATTTGAAATAATTATTTTACTGACTATTTTTGCCAATTGTGTGGCC
TTAGCGATCTATATTCCCTTTCCAGAAGATGATTCCAACGCCACCAATTCCAACCTGGAA
CGAGTGGAATATCTCTTTCTCATAATTTTTACGGTGGAAGCGTTTTTAAAAGTAATCGCC
TATGGACTCCTCTTTCACCCCAATGCCTACCTCCGCAACGGCTGGAACCTACTAGATTTT
ATAATTGTGGTTGTGGGGCTTTTTAGTGCAATTTTAGAACAAGCAACCAAAGCAGATGGG
GCAAACGCTCTCGGAGGGAAAGGGGCCGGATTTGATGTGAAGGCGCTGAGGGCCTTCCGC
GTGCTGCGCCCCCTGCGGCTGGTGTCCGGAGTCCCAAGTCTCCAGGTGGTCCTGAATTCC
ATCATCAAGGCCATGGTCCCCCTGCTGCACATCGCCCTGCTTGTGCTGTTTGTCATCATC
ATCTACGCCATCATCGGCTTGGAGCTCTTCATGGGGAAGATGCACAAGACCTGCTACAAC
CAGGAGGGCATAGCAGATGTTCCAGCAGAAGATGACCCTTCCCCTTGTGCGCTGGAAACG
GGCCACGGGCGGCAGTGCCAGAACGGCACGGTGTGCAAGCCCGGCTGGGATGGTCCCAAG
CACGGCATCACCAACTTTGACAACTTTGCCTTCGCCATGCTCACGGTGTTCCAGTGCATC
ACCATGGAGGGCTGGACGGACGTGCTGTACTGGGTCAATGATGCCGTAGGAAGGGACTGG
CCCTGGATCTATTTTGTTACACTAATCATCATAGGGTCATTTTTTGTACTTAACTTGGTT
CTCGGTGTGCTTAGCGGAGAGTTTTCCAAAGAGAGGGAGAAGGCCAAGGCCCGGGGAGAT
TTCCAGAAGCTGCGGGAGAAGCAGCAGCTAGAAGAGGATCTCAAAGGCTACCTGGATTGG
ATCACTCAGGCCGAAGACATCGATCCTGAGAATGAGGACGAAGGCATGGATGAGGAGAAG
CCCCGAAACATGAGCATGCCCACCAGTGAGACCGAGTCCGTCAACACCGAAAACGTGGCT
GGAGGTGACATCGAGGGAGAAAACTGCGGGGCCAGGCTGGCCCACCGGATCTCCAAGTCA
AAGTTCAGCCGCTACTGGCGCCGGTGGAATCGGTTCTGCAGAAGGAAGTGCCGCGCCGCA
GTCAAGTCTAATGTCTTCTACTGGCTGGTGATTTTCCTGGTGTTCCTCAACACGCTCACC
ATTGCCTCTGAGCACTACAACCAGCCCAACTGGCTCACAGAAGTCCAAGACACGGCAAAC
AAGGCCCTGCTGGCCCTGTTCACGGCAGAGATGCTCCTGAAGATGTACAGCCTGGGCCTG
CAGGCCTACTTCGTGTCCCTCTTCAACCGCTTTGACTGCTTCGTCGTGTGTGGCGGCATC
CTGGAGACCATCCTGGTGGAGACCAAGATCATGTCCCCACTGGGCATCTCCGTGCTCAGA
TGCGTCCGGCTGCTGAGGATTTTCAAGATCACGAGGTACTGGAACTCCTTGAGCAACCTG
GTGGCATCCTTGCTGAACTCTGTGCGCTCCATCGCCTCCCTGCTCCTTCTCCTCTTCCTC
TTCATCATCATCTTCTCCCTCCTGGGGATGCAGCTCTTTGGAGGAAAGTTCAACTTTGAT
GAGATGCAGACCCGGAGGAGCACATTCGATAACTTCCCCCAGTCCCTCCTCACTGTGTTT
CAGATCCTGACCGGGGAGGACTGGAATTCGGTGATGTATGATGGGATCATGGCTTATGGC
GGCCCCTCTTTTCCAGGGATGTTAGTCTGTATTTACTTCATCATCCTCTTCATCTGTGGA
AACTATATCCTACTGAATGTGTTCTTGGCCATTGCTGTGGACAACCTGGCTGATGCTGAG
AGCCTCACATCTGCCCAAAAGGAGGAGGAAGAGGAGAAGGAGAGAAAGAAGCTGGCCAGG
ACTGCCAGCCCAGAGAAGAAACAAGAGTTGGTGGAGAAGCCGGCAGTGGGGGAATCCAAG
GAGGAGAAGATTGAGCTGAAATCCATCACGGCTGACGGAGAGTCTCCACCCGCCACCAAG
ATCAACATGGATGACCTCCAGCCCAATGAAAATGAGGATAAGAGCCCCTACCCCAACCCA
GAAACTACAGGAGAAGAGGATGAGGAGGAGCCAGAGATGCCTGTCGGCCCTCGCCCACGA
CCACTCTCTGAGCTTCACCTTAAGGAAAAGGCAGTGCCCATGCCAGAAGCCAGCGCGTTT
TTCATCTTCAGCTCTAACAACAGGTTTCGCCTCCAGTGCCACCGCATTGTCAATGACACG
ATCTTCACCAACCTGATCCTCTTCTTCATTCTGCTCAGCAGCATTTCCCTGGCTGCTGAG
GACCCGGTCCAGCACACCTCCTTCAGGAACCATATTCTGTTTTATTTTGATATTGTTTTT
ACCACCATTTTCACCATTGAAATTGCTCTGAAGATCCTAGGCAATGCAGACTATGTCTTC
ACTAGTATCTTTACATTAGAAATTATCCTTAAGATGACTGCTTATGGGGCTTTCTTGCAC
AAGGGTTCTTTCTGCCGGAACTACTTCAACATCCTGGACCTGCTGGTGGTCAGCGTGTCC
CTCATCTCCTTTGGCATCCAGTCCAGTGCAATCAATGTCGTGAAGATCTTGCGAGTCCTG
CGAGTACTCAGGCCCCTGAGGGCCATCAACAGGGCCAAGGGGCTAAAGCATGTGGTTCAG
TGTGTGTTTGTCGCCATCCGGACCATCGGGAACATCGTGATTGTCACCACCCTGCTGCAG
TTCATGTTTGCCTGCATCGGGGTCCAGCTCTTCAAGGGAAAGCTGTACACCTGTTCAGAC
AGTTCCAAGCAGACAGAGGCGGAATGCAAGGGCAACTACATCACGTACAAAGACGGGGAG
GTTGACCACCCCATCATCCAACCCCGCAGCTGGGAGAACAGCAAGTTTGACTTTGACAAT
GTTCTGGCAGCCATGATGGCCCTCTTCACCGTCTCCACCTTCGAAGGGTGGCCAGAGCTG
CTGTACCGCTCCATCGACTCCCACACGGAAGACAAGGGCCCCATCTACAACTACCGTGTG
GAGATCTCCATCTTCTTCATCATCTACATCATCATCATCGCCTTCTTCATGATGAACATC
TTCGTGGGCTTCGTCATCGTCACCTTTCAGGAGCAGGGGGAGCAGGAGTACAAGAACTGT
GAGCTGGACAAGAACCAGCGACAGTGCGTGGAATACGCCCTCAAGGCCCGGCCCCTGCGG
AGGTACATCCCCAAGAACCAGCACCAGTACAAAGTGTGGTACGTGGTCAACTCCACCTAC
TTCGAGTACCTGATGTTCGTCCTCATCCTGCTCAACACCATCTGCCTGGCCATGCAGCAC
TACGGCCAGAGCTGCCTGTTCAAAATCGCCATGAACATCCTCAACATGCTCTTCACTGGC
CTCTTCACCGTGGAGATGATCCTGAAGCTCATTGCCTTCAAACCCAAGGGTTACTTTAGT
GATCCCTGGAATGTTTTTGACTTCCTCATCGTAATTGGCAGCATAATTGACGTCATTCTC
AGTGAGACTAATCACTATTTCTGTGATGCATGGAATACATTTGACGCCTTGATTGTTGTG
GGTAGCATTGTTGATATAGCAATCACCGAGGTAAACCCAGCTGAACATACCCAATGCTCT
CCCTCTATGAACGCAGAGGAAAACTCCCGCATCTCCATCACCTTCTTCCGCCTGTTCCGG
GTCATGCGTCTGGTGAAGCTGCTGAGCCGTGGGGAGGGCATCCGGACGCTGCTGTGGACC
TTCATCAAGTCCTTCCAGGCCCTGCCCTATGTGGCCCTCCTGATCGTGATGCTGTTCTTC
ATCTACGCGGTGATCGGGATGCAGGTGTTTGGGAAAATTGCCCTGAATGATACCACAGAG
ATCAACCGGAACAACAACTTTCAGACCTTCCCCCAGGCCGTGCTGCTCCTCTTCAGGTGT
GCCACCGGGGAGGCCTGGCAGGACATCATGCTGGCCTGCATGCCAGGCAAGAAGTGTGCC
CCAGAGTCCGAGCCCAGCAACAGCACGGAGGGTGAAACACCCTGTGGTAGCAGCTTTGCT
GTCTTCTACTTCATCAGCTTCTACATGCTCTGTGCCTTCCTGATCATCAACCTCTTTGTA
GCTGTCATCATGGACAACTTTGACTACCTGACAAGGGACTGGTCCATCCTTGGTCCCCAC
CACCTGGATGAGTTTAAAAGAATCTGGGCAGAGTATGACCCTGAAGCCAAGGGTCGTATC
AAACACCTGGATGTGGTGACCCTCCTCCGGCGGATTCAGCCGCCACTAGGTTTTGGGAAG
CTGTGCCCTCACCGCGTGGCTTGCAAACGCCTGGTCTCCATGAACATGCCTCTGAACAGC
GACGGGACAGTCATGTTCAATGCCACCCTGTTTGCCCTGGTCAGGACGGCCCTGAGGATC
AAAACAGAAGGGAACCTAGAACAAGCCAATGAGGAGCTGCGGGCGATCATCAAGAAGATC
TGGAAGCGGACCAGCATGAAGCTGCTGGACCAGGTGGTGCCCCCTGCAGGTGATGATGAG
GTCACCGTTGGCAAGTTCTACGCCACGTTCCTGATCCAGGAGTACTTCCGGAAGTTCAAG
AAGCGCAAAGAGCAGGGCCTTGTGGGCAAGCCCTCCCAGAGGAACGCGCTGTCTCTGCAG
GCTGGCTTGCGCACACTGCATGACATCGGGCCTGAGATCCGACGGGCCATCTCTGGAGAT
CTCACCGCTGAGGAGGAGCTGGACAAGGCCATGAAGGAGGCTGTGTCCGCTGCTTCTGAA
GATGACATCTTCAGGAGGGCCGGTGGCCTGTTCGGCAACCACGTCAGCTACTACCAAAGC
GACGGCCGGAGCGCCTTCCCCCAGACCTTCACCACTCAGCGCCCGCTGCACATCAACAAG
GCGGGCAGCAGCCAGGGCGACACTGAGTCGCCATCCCACGAGAAGCTGGTGGACTCCACC
TTCACCCCGAGCAGCTACTCGTCCACCGGCTCCAACGCCAACATCAACAACGCCAACAAC
ACCGCCCTGGGTCGCCTCCCTCGCCCCGCCGGCTACCCCAGCACGGTCAGCACTGTGGAG
GGCCACGGGCCCCCCTTGTCCCCTGCCATCCGGGTGCAGGAGGTGGCGTGGAAGCTCAGC
TCCAACAGGGAAAGGCACGTTCCGATGTGTGAGGATCTGGAGCTCAGGAGGGATTCAGGC
TCAGCAGGGACTCAGGCTCACTGCCTTCTGCTCAGGAAAGCAAACCCCTCTAGGTGCCAC
TCCCGGGAGAGCCAGGCAGCCATGGCGGGTCAGGAGGAGACGTCTCAGGATGAGACCTAT
GAAGTGAAGATGAACCATGACACGGAGGCCTGCAGTGAGCCCAGCCTGCTCTCCACAGAG
ATGCTCTCCTACCAGGATGACGAAAATCGGCAACTGACGCTCCCAGAGGAGGACAAGAGG
GACATCCGGCAATCTCCGAAGAGGGGTTTCCTCCGCTCTGCCTCACTAGGTCGAAGGGCC
TCCTTCCACCTGGAATGTCTGAAGCGACAGAAGGACCGAGGGGGAGACATCTCTCAGAAG
ACAGTCCTGCCCTTGCATCTGGTTCATCATCAGGCATTGGCAGTGGCAGGCCTGAGCCCC
CTCCTCCAGAGAAGCCATTCCCCTGCCTCATTCCCTAGGCCTTTTGCCACCCCACCAGCC
ACACCTGGCAGCCGAGGCTGGCCCCCACAGCCCGTCCCCACCCTGCGGCTTGAGGGGGTC
GAGTCCAGTGAGAAACTCAACAGCAGCTTCCCATCCATCCACTGCGGCTCCTGGGCTGAG
ACCACCCCCGGTGGCGGGGGCAGCAGCGCCGCCCGGAGAGTCCGGCCCGTCTCCCTCATG
GTGCCCAGCCAGGCTGGGGCCCCAGGGAGGCAGTTCCACGGCAGTGCCAGCAGCCTGGTG
GAAGCGGTCTTGATTTCAGAAGGACTGGGGCAGTTTGCTCAAGATCCCAAGTTCATCGAG
GTCACCACCCAGGAGCTGGCCGACGCCTGCGACATGACCATAGAGGAGATGGAGAGCGCG
GCCGACAACATCCTCAGCGGGGGCGCCCCACAGAGCCCCAATGGCGCCCTCTTACCCTTT
GTGAACTGCAGGGACGCGGGGCAGGACCGAGCCGGGGGCGAAGAGGACGCGGGCTGTGTG
CGCGCGCGGGGTCGACCGAGTGAGGAGGAGCTCCAGGACAGCAGGGTCTACGTCAGCAGC
CTGTAG
Protein Properties
Number of Residues 2221
Molecular Weight 248974.1
Theoretical pI 6.74
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 125-143
  • 161-181
  • 194-212
  • 233-251
  • 271-290
  • 381-405
  • 525-543
  • 559-578
  • 587-605
  • 616-634
  • 654-673
  • 729-753
  • 901-919
  • 936-955
  • 988-1006
  • 1014-1032
  • 1052-1071
  • 1162-1186
  • 1240-1258
  • 1274-1293
  • 1302-1320
  • 1373-1391
  • 1411-1430
  • 1500-1524
Protein Sequence
>Voltage-dependent L-type calcium channel subunit alpha-1C
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLT
IASEHYNQPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQELVEKPAVGESKEEKIELKSITADGESPPATKINMDDLQPNENEDKSPYPNP
ETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDT
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNADYVF
TSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVL
RVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSD
SSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPEL
LYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNC
ELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQH
YGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVIL
SETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEENSRISITFFRLFR
VMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTE
INRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFA
VFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRI
KHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRI
KTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFK
KRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASE
DDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDTESPSHEKLVDST
FTPSSYSSTGSNANINNANNTALGRLPRPAGYPSTVSTVEGHGPPLSPAIRVQEVAWKLS
SNRERHVPMCEDLELRRDSGSAGTQAHCLLLRKANPSRCHSRESQAAMAGQEETSQDETY
EVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLGRRA
SFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPA
TPGSRGWPPQPVPTLRLEGVESSEKLNSSFPSIHCGSWAETTPGGGGSSAARRVRPVSLM
VPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESA
ADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSS
L
GenBank ID Protein 193788720
UniProtKB/Swiss-Prot ID Q13936
UniProtKB/Swiss-Prot Entry Name CAC1C_HUMAN
PDB IDs
GenBank Gene ID NM_199460.2
GeneCard ID CACNA1C
GenAtlas ID CACNA1C
HGNC ID HGNC:1390
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  3. Soldatov NM: Molecular diversity of L-type Ca2+ channel transcripts in human fibroblasts. Proc Natl Acad Sci U S A. 1992 May 15;89(10):4628-32. [PubMed:1316612 ]
  4. Schultz D, Mikala G, Yatani A, Engle DB, Iles DE, Segers B, Sinke RJ, Weghuis DO, Klockner U, Wakamori M, et al.: Cloning, chromosomal localization, and functional expression of the alpha 1 subunit of the L-type voltage-dependent calcium channel from normal human heart. Proc Natl Acad Sci U S A. 1993 Jul 1;90(13):6228-32. [PubMed:8392192 ]
  5. Soldatov NM: Genomic structure of human L-type Ca2+ channel. Genomics. 1994 Jul 1;22(1):77-87. [PubMed:7959794 ]
  6. Soldatov NM, Bouron A, Reuter H: Different voltage-dependent inhibition by dihydropyridines of human Ca2+ channel splice variants. J Biol Chem. 1995 May 5;270(18):10540-3. [PubMed:7737988 ]
  7. Klockner U, Mikala G, Eisfeld J, Iles DE, Strobeck M, Mershon JL, Schwartz A, Varadi G: Properties of three COOH-terminal splice variants of a human cardiac L-type Ca2+-channel alpha1-subunit. Am J Physiol. 1997 Mar;272(3 Pt 2):H1372-81. [PubMed:9087614 ]
  8. Soldatov NM, Zuhlke RD, Bouron A, Reuter H: Molecular structures involved in L-type calcium channel inactivation. Role of the carboxyl-terminal region encoded by exons 40-42 in alpha1C subunit in the kinetics and Ca2+ dependence of inactivation. J Biol Chem. 1997 Feb 7;272(6):3560-6. [PubMed:9013606 ]
  9. Zuhlke RD, Bouron A, Soldatov NM, Reuter H: Ca2+ channel sensitivity towards the blocker isradipine is affected by alternative splicing of the human alpha1C subunit gene. FEBS Lett. 1998 May 8;427(2):220-4. [PubMed:9607315 ]
  10. Lyford GL, Strege PR, Shepard A, Ou Y, Ermilov L, Miller SM, Gibbons SJ, Rae JL, Szurszewski JH, Farrugia G: alpha(1C) (Ca(V)1.2) L-type calcium channel mediates mechanosensitive calcium regulation. Am J Physiol Cell Physiol. 2002 Sep;283(3):C1001-8. [PubMed:12176756 ]
  11. Tiwari S, Zhang Y, Heller J, Abernethy DR, Soldatov NM: Atherosclerosis-related molecular alteration of the human CaV1.2 calcium channel alpha1C subunit. Proc Natl Acad Sci U S A. 2006 Nov 7;103(45):17024-9. Epub 2006 Oct 27. [PubMed:17071743 ]
  12. Blumenstein Y, Kanevsky N, Sahar G, Barzilai R, Ivanina T, Dascal N: A novel long N-terminal isoform of human L-type Ca2+ channel is up-regulated by protein kinase C. J Biol Chem. 2002 Feb 1;277(5):3419-23. Epub 2001 Dec 11. [PubMed:11741969 ]
  13. Perez-Reyes E, Wei XY, Castellano A, Birnbaumer L: Molecular diversity of L-type calcium channels. Evidence for alternative splicing of the transcripts of three non-allelic genes. J Biol Chem. 1990 Nov 25;265(33):20430-6. [PubMed:2173707 ]
  14. Powers PA, Gregg RG, Lalley PA, Liao M, Hogan K: Assignment of the human gene for the alpha 1 subunit of the cardiac DHP-sensitive Ca2+ channel (CCHL1A1) to chromosome 12p12-pter. Genomics. 1991 Jul;10(3):835-9. [PubMed:1653763 ]
  15. Sun W, McPherson JD, Hoang DQ, Wasmuth JJ, Evans GA, Montal M: Mapping of a human brain voltage-gated calcium channel to human chromosome 12p13-pter. Genomics. 1992 Dec;14(4):1092-4. [PubMed:1335957 ]
  16. Tang S, Mikala G, Bahinski A, Yatani A, Varadi G, Schwartz A: Molecular localization of ion selectivity sites within the pore of a human L-type cardiac calcium channel. J Biol Chem. 1993 Jun 25;268(18):13026-9. [PubMed:8099908 ]
  17. Qin N, Yagel S, Momplaisir ML, Codd EE, D'Andrea MR: Molecular cloning and characterization of the human voltage-gated calcium channel alpha(2)delta-4 subunit. Mol Pharmacol. 2002 Sep;62(3):485-96. [PubMed:12181424 ]
  18. Zhou H, Kim SA, Kirk EA, Tippens AL, Sun H, Haeseleer F, Lee A: Ca2+-binding protein-1 facilitates and forms a postsynaptic complex with Cav1.2 (L-type) Ca2+ channels. J Neurosci. 2004 May 12;24(19):4698-708. [PubMed:15140941 ]
  19. Zhou H, Yu K, McCoy KL, Lee A: Molecular mechanism for divergent regulation of Cav1.2 Ca2+ channels by calmodulin and Ca2+-binding protein-1. J Biol Chem. 2005 Aug 19;280(33):29612-9. Epub 2005 Jun 26. [PubMed:15980432 ]
  20. Van Petegem F, Clark KA, Chatelain FC, Minor DL Jr: Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain. Nature. 2004 Jun 10;429(6992):671-5. Epub 2004 May 12. [PubMed:15141227 ]
  21. Splawski I, Timothy KW, Sharpe LM, Decher N, Kumar P, Bloise R, Napolitano C, Schwartz PJ, Joseph RM, Condouris K, Tager-Flusberg H, Priori SG, Sanguinetti MC, Keating MT: Ca(V)1.2 calcium channel dysfunction causes a multisystem disorder including arrhythmia and autism. Cell. 2004 Oct 1;119(1):19-31. [PubMed:15454078 ]
  22. Splawski I, Timothy KW, Decher N, Kumar P, Sachse FB, Beggs AH, Sanguinetti MC, Keating MT: Severe arrhythmia disorder caused by cardiac L-type calcium channel mutations. Proc Natl Acad Sci U S A. 2005 Jun 7;102(23):8089-96; discussion 8086-8. Epub 2005 Apr 29. [PubMed:15863612 ]
  23. Antzelevitch C, Pollevick GD, Cordeiro JM, Casis O, Sanguinetti MC, Aizawa Y, Guerchicoff A, Pfeiffer R, Oliva A, Wollnik B, Gelber P, Bonaros EP Jr, Burashnikov E, Wu Y, Sargent JD, Schickel S, Oberheiden R, Bhatia A, Hsu LF, Haissaguerre M, Schimpf R, Borggrefe M, Wolpert C: Loss-of-function mutations in the cardiac calcium channel underlie a new clinical entity characterized by ST-segment elevation, short QT intervals, and sudden cardiac death. Circulation. 2007 Jan 30;115(4):442-9. Epub 2007 Jan 15. [PubMed:17224476 ]