You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02268
Secondary Accession Numbers
  • 7753
Name 5-hydroxytryptamine receptor 7
Synonyms
  1. 5-HT-7
  2. 5-HT-X
  3. 5-HT7
  4. Serotonin receptor 7
Gene Name HTR7
Protein Type Enzyme
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase
Pathways
  • Excitatory Neural Signalling Through 5-HTR 7 and Serotonin
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 10q21-q24
SNPs HTR7
Gene Sequence
>1440 bp
ATGATGGACGTTAACAGCAGCGGCCGCCCGGACCTCTACGGGCACCTCCGCTCTTTCCTT
CTGCCAGAAGTGGGGCGCGGGCTGCCCGACTTGAGCCCCGACGGTGGCGCCGACCCGGTC
GCGGGCTCCTGGGCGCCGCACCTGCTGAGCGAGGTGACAGCCAGCCCGGCGCCCACCTGG
GACGCGCCCCCGGACAATGCCTCCGGCTGTGGGGAACAGATCAACTACGGCAGAGTCGAG
AAAGTTGTGATCGGCTCCATCCTGACGCTCATCACGCTGCTGACGATCGCGGGCAACTGC
CTGGTGGTGATCTCCGTGTGCTTCGTCAAGAAGCTCCGCCAGCCCTCCAACTACCTGATC
GTGTCCCTGGCGCTGGCCGACCTCTCGGTGGCTGTGGCGGTCATGCCCTTCGTCAGCGTC
ACCGACCTCATCGGGGGCAAGTGGATCTTTGGACACTTTTTCTGTAATGTCTTCATCGCC
ATGGACGTCATGTGCTGCACGGCCTCGATCATGACCCTGTGCGTGATCAGCATTGACAGG
TACCTTGGGATCACAAGGCCCCTCACATACCCTGTGAGGCAGAATGGGAAATGCATGGCG
AAGATGATTCTCTCCGTCTGGCTTCTCTCCGCCTCCATCACCTTACCTCCACTCTTTGGA
TGGGCTCAGAATGTAAATGATGATAAGGTGTGCTTGATCAGCCAGGACTTTGGCTATACG
ATTTACTCTACCGCAGTGGCATTTTATATCCCCATGTCCGTCATGCTTTTCATGTACTAC
CAGATTTACAAGGCTGCCAGGAAGAGTGCTGCCAAACACAAGTTTCCTGGCTTCCCTCGA
GTGGAGCCAGACAGCGTCATCGCCCTGAATGGCATAGTGAAGCTCCAGAAGGAGGTGGAA
GAGTGTGCAAACCTTTCGAGACTCCTCAAGCATGAAAGGAAAAACATCTCCATCTTTAAG
CGAGAACAGAAAGCAGCCACCACCCTGGGGATCATCGTCGGGGCCTTTACCGTGTGCTGG
CTGCCATTTTTCCTCCTCTCGACAGCCAGACCCTTCATCTGTGGCACTTCCTGCAGCTGC
ATCCCACTGTGGGTGGAGAGGACATTTCTGTGGCTAGGCTATGCAAACTCTCTCATTAAC
CCTTTTATATATGCCTTCTTCAACCGGGACCTGAGGACCACCTATCGCAGCCTGCTCCAG
TGCCAGTACCGGAATATCAACCGGAAGCTCTCAGCTGCAGGCATGCATGAAGCCCTGAAG
CTTGCTGAGAGGCCAGAGAGACCTGAGTTTGTGCTGAGGGCCTGCACAAGGAGGGTGCTG
TTGAGACCAGAAAAGAGGCCACCGGTATCTGTGTGGGTGCTACAATCTCCAGACCATCAC
AATTGGTTAGCAGACAAAATGCTGACTACTGTAGAAAAAAAGGTCATGATTCATGATTGA
Protein Properties
Number of Residues 479
Molecular Weight 53554.4
Theoretical pI 8.97
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 84-104
  • 118-138
  • 158-178
  • 202-222
  • 237-257
  • 326-346
  • 368-388
Protein Sequence
>5-hydroxytryptamine receptor 7
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
GenBank ID Protein 10880129
UniProtKB/Swiss-Prot ID P34969
UniProtKB/Swiss-Prot Entry Name 5HT7R_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_019859.3
GeneCard ID HTR7
GenAtlas ID HTR7
HGNC ID HGNC:5302
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  3. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. [PubMed:19054851 ]
  4. Heidmann DE, Metcalf MA, Kohen R, Hamblin MW: Four 5-hydroxytryptamine7 (5-HT7) receptor isoforms in human and rat produced by alternative splicing: species differences due to altered intron-exon organization. J Neurochem. 1997 Apr;68(4):1372-81. [PubMed:9084407 ]
  5. Bard JA, Zgombick J, Adham N, Vaysse P, Branchek TA, Weinshank RL: Cloning of a novel human serotonin receptor (5-HT7) positively linked to adenylate cyclase. J Biol Chem. 1993 Nov 5;268(31):23422-6. [PubMed:8226867 ]
  6. Erdmann J, Nothen MM, Shimron-Abarbanell D, Rietschel M, Albus M, Borrmann M, Maier W, Franzek E, Korner J, Weigelt B, Fimmers R, Propping P: The human serotonin 7 (5-HT7) receptor gene: genomic organization and systematic mutation screening in schizophrenia and bipolar affective disorder. Mol Psychiatry. 1996 Nov;1(5):392-7. [PubMed:9154233 ]