You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02339
Secondary Accession Numbers
  • 7827
Name Choline transporter-like protein 1
Synonyms
  1. CD92 antigen
  2. CDw92
  3. Solute carrier family 44 member 1
Gene Name SLC44A1
Protein Type Transporter
Biological Properties
General Function Involved in choline transmembrane transporter activity
Specific Function Choline transporter. May be involved in membrane synthesis and myelin production.
Pathways
  • Sarcosine Oncometabolite Pathway
Reactions Not Available
GO Classification
Biological Process
phosphatidylcholine biosynthetic process
Cellular Component
plasma membrane
mitochondrial outer membrane
integral to membrane
Molecular Function
choline transmembrane transporter activity
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Multi-pass membrane protein
  4. Mitochondrion outer membrane
Gene Properties
Chromosome Location 9
Locus 9q31.2
SNPs SLC44A1
Gene Sequence
>1974 bp
ATGGGCTGCTGCAGCTCCGCCTCCTCCGCCGCGCAGAGCTCCAAACGAGAATGGAAGCCG
CTGGAGGACCGTAGCTGCACAGACATACCATGGCTGCTGCTCTTCATCCTCTTCTGCATT
GGGATGGGATTTATTTGTGGCTTTTCAATAGCAACAGGTGCAGCAGCAAGACTAGTGTCA
GGATACGACAGCTATGGAAATATCTGTGGGCAGAAAAATACAAAGTTGGAAGCAATACCA
AACAGTGGCATGGACCACACCCAGCGGAAGTATGTATTCTTTTTGGATCCATGCAACCTG
GACTTGATAAACCGGAAGATTAAGTCTGTAGCACTGTGTGTAGCAGCGTGTCCAAGGCAA
GAACTGAAAACTCTGAGTGATGTTCAGAAGTTTGCAGAGATAAATGGTTCAGCCCTATGT
AGCTACAACCTAAAGCCTTCTGAATACACTACATCTCCAAAATCTTCTGTTCTCTGCCCC
AAACTACCAGTTCCAGCGAGTGCACCTATTCCATTCTTCCATCGCTGTGCTCCTGTGAAC
ATTTCCTGCTATGCCAAGTTTGCAGAGGCCCTGATCACCTTTGTCAGTGACAATAGTGTC
TTACACAGGCTGATTAGTGGAGTAATGACCAGCAAAGAAATTATATTGGGACTTTGCTTG
TTATCACTAGTTCTATCCATGATTTTGATGGTGATAATCAGGTATATATCAAGAGTACTT
GTGTGGATCTTAACGATTCTGGTCATACTCGGTTCACTTGGAGGCACAGGTGTACTATGG
TGGCTGTATGCAAAGCAAAGAAGGTCTCCCAAAGAAACTGTTACTCCTGAGCAGCTTCAG
ATAGCTGAAGACAATCTTCGGGCCCTCCTCATTTATGCCATTTCAGCTACAGTGTTCACA
GTGATCTTATTCCTGATAATGTTGGTTATGCGCAAACGTGTTGCTCTTACCATCGCCTTG
TTCCACGTAGCTGGCAAGGTCTTCATTCACTTGCCACTGCTAGTCTTCCAACCCTTCTGG
ACTTTCTTTGCTCTTGTCTTGTTTTGGGTGTACTGGATCATGACACTTCTTTTTCTTGGC
ACTACCGGCAGTCCTGTTCAGAATGAGCAAGGCTTTGTGGAGTTCAAAATTTCTGGGCCT
CTGCAGTACATGTGGTGGTACCATGTGGTGGGCCTGATTTGGATCAGTGAATTTATTCTA
GCATGTCAGCAGATGACAGTGGCAGGAGCTGTGGTAACATACTATTTTACTAGGGATAAA
AGGAATTTGCCATTTACACCTATTTTGGCATCAGTAAATCGCCTTATTCGTTACCACCTA
GGTACGGTGGCAAAAGGATCTTTCATTATCACATTAGTCAAAATTCCGCGAATGATCCTT
ATGTATATTCACAGTCAGCTCAAAGGAAAGGAAAATGCTTGTGCACGATGTGTGCTGAAA
TCTTGCATTTGTTGCCTTTGGTGTCTTGAAAAGTGCCTAAATTATTTAAATCAGAATGCA
TACACAGCCACAGCTATCAACAGCACCAACTTCTGCACCTCAGCAAAGGATGCCTTTGTC
ATTCTGGTGGAGAATGCTTTGCGAGTGGCTACCATCAACACAGTAGGAGATTTTATGTTA
TTCCTTGGCAAGGTGCTGATAGTCTGCAGCACAGGTTTAGCTGGGATTATGCTGCTCAAC
TACCAGCAGGACTACACAGTATGGGTGCTGCCTCTGATCATCGTCTGCCTCTTTGCTTTC
CTAGTCGCTCATTGCTTCCTGTCTATTTATGAAATGGTAGTGGATGTATTATTCTTGTGT
TTTGCCATTGATACAAAATACAATGATGGGAGCCCTGGCAGAGAATTCTATATGGATAAA
GTGCTGATGGAGTTTGTGGAAAACAGTAGGAAAGCAATGAAAGAAGCTGGTAAGGGAGGC
GTCGCTGATTCCAGAGAGCTAAAGCCGATGGCTTCGGGAGCAAGTTCTGCTTGA
Protein Properties
Number of Residues 657
Molecular Weight 73301.28
Theoretical pI 8.602
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Choline transporter-like protein 1
MGCCSSASSAAQSSKREWKPLEDRSCTDIPWLLLFILFCIGMGFICGFSIATGAAARLVS
GYDSYGNICGQKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQ
ELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVN
ISCYAKFAEALITFVSDNSVLHRLISGVMTSKEIILGLCLLSLVLSMILMVIIRYISRVL
VWILTILVILGSLGGTGVLWWLYAKQRRSPKETVTPEQLQIAEDNLRALLIYAISATVFT
VILFLIMLVMRKRVALTIALFHVAGKVFIHLPLLVFQPFWTFFALVLFWVYWIMTLLFLG
TTGSPVQNEQGFVEFKISGPLQYMWWYHVVGLIWISEFILACQQMTVAGAVVTYYFTRDK
RNLPFTPILASVNRLIRYHLGTVAKGSFIITLVKIPRMILMYIHSQLKGKENACARCVLK
SCICCLWCLEKCLNYLNQNAYTATAINSTNFCTSAKDAFVILVENALRVATINTVGDFML
FLGKVLIVCSTGLAGIMLLNYQQDYTVWVLPLIIVCLFAFLVAHCFLSIYEMVVDVLFLC
FAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADSRELKPMASGASSA
GenBank ID Protein 18034692
UniProtKB/Swiss-Prot ID Q8WWI5
UniProtKB/Swiss-Prot Entry Name CTL1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_080546.3
GeneCard ID SLC44A1
GenAtlas ID SLC44A1
HGNC ID HGNC:18798
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  4. O'Regan S, Traiffort E, Ruat M, Cha N, Compaore D, Meunier FM: An electric lobe suppressor for a yeast choline transport mutation belongs to a new family of transporter-like proteins. Proc Natl Acad Sci U S A. 2000 Feb 15;97(4):1835-40. [PubMed:10677542 ]
  5. Wille S, Szekeres A, Majdic O, Prager E, Staffler G, Stockl J, Kunthalert D, Prieschl EE, Baumruker T, Burtscher H, Zlabinger GJ, Knapp W, Stockinger H: Characterization of CDw92 as a member of the choline transporter-like protein family regulated specifically on dendritic cells. J Immunol. 2001 Nov 15;167(10):5795-804. [PubMed:11698453 ]
  6. Traiffort E, Ruat M, O'Regan S, Meunier FM: Molecular characterization of the family of choline transporter-like proteins and their splice variants. J Neurochem. 2005 Mar;92(5):1116-25. [PubMed:15715662 ]
  7. Michel V, Bakovic M: The solute carrier 44A1 is a mitochondrial protein and mediates choline transport. FASEB J. 2009 Aug;23(8):2749-58. doi: 10.1096/fj.08-121491. Epub 2009 Apr 8. [PubMed:19357133 ]