Hmdb loader
Survey

Showing Protein Cytochrome c oxidase subunit 7A1, mitochondrial (HMDBP02366)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 3 metabolites
Identification
HMDB Protein ID HMDBP02366
Secondary Accession Numbers
  • 7855
  • HMDBP07039
Name Cytochrome c oxidase subunit 7A1, mitochondrial
Synonyms
  1. Cytochrome c oxidase subunit VIIa-H
  2. Cytochrome c oxidase subunit VIIa-M
  3. Cytochrome c oxidase subunit VIIa-heart
  4. Cytochrome c oxidase subunit VIIa-muscle
Gene Name COX7A1
Protein Type Enzyme
Biological Properties
General Function Involved in cytochrome-c oxidase activity
Specific Function This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
mitochondrial membrane part
mitochondrial respiratory chain
Function
catalytic activity
electron carrier activity
oxidoreductase activity
heme-copper terminal oxidase activity
cytochrome-c oxidase activity
Cellular Location
  1. Mitochondrion inner membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.1
SNPs COX7A1
Gene Sequence 
>240 bp
ATGCAGGCCCTTCGGGTGTCCCAGGCGCTGATCCGCTCCTTCAGCTCCACCGCCCGGAAC
CGCTTTCAGAACCGAGTGCGCGAGAAACAGAAGCTCTTCCAGGAGGACAATGACATCCCG
TTGTACCTGAAGGGCGGCATCGTTGACAACATCCTGTACCGAGTGACAATGACGCTGTGT
CTGGGCGGCACTGTCTACAGCTTGTACTCCCTTGGCTGGGCCTCCTTCCCCAGGAATTAA
Protein Properties
Number of Residues 79
Molecular Weight 9117.4
Theoretical pI 10.52
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 47-75
Protein Sequence 
>Cytochrome c oxidase subunit 7A1, mitochondrial
MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLC
LGGTVYSLYSLGWASFPRN
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P24310
UniProtKB/Swiss-Prot Entry Name CX7A1_HUMAN
PDB IDs Not Available
GenBank Gene ID M83186
GeneCard ID COX7A1
GenAtlas ID COX7A1
HGNC ID HGNC:2287
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Arnaudo E, Hirano M, Seelan RS, Milatovich A, Hsieh CL, Fabrizi GM, Grossman LI, Francke U, Schon EA: Tissue-specific expression and chromosome assignment of genes specifying two isoforms of subunit VIIa of human cytochrome c oxidase. Gene. 1992 Oct 1;119(2):299-305. [PubMed:1327965 ]
  4. Wolz W, Kress W, Mueller CR: Genomic sequence and organization of the human gene for cytochrome c oxidase subunit (COX7A1) VIIa-M. Genomics. 1997 Oct 15;45(2):438-42. [PubMed:9344674 ]
  5. Yu M, Jaradat SA, Grossman LI: Genomic organization and promoter regulation of human cytochrome c oxidase subunit VII heart/muscle isoform (COX7AH). Biochim Biophys Acta. 2002 Apr 12;1574(3):345-53. [PubMed:11997101 ]
  6. Schmidt TR, Goodman M, Grossman LI: Molecular evolution of the COX7A gene family in primates. Mol Biol Evol. 1999 May;16(5):619-26. [PubMed:10335655 ]
  7. Van Kuilenburg AB, Van Beeumen JJ, Van der Meer NM, Muijsers AO: Subunits VIIa,b,c of human cytochrome c oxidase. Identification of both 'heart-type' and 'liver-type' isoforms of subunit VIIa in human heart. Eur J Biochem. 1992 Jan 15;203(1-2):193-9. [PubMed:1309697 ]