You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02367
Secondary Accession Numbers
  • 7857
Name Transient receptor potential cation channel subfamily V member 6
Synonyms
  1. CaT-L
  2. CaT-like
  3. CaT1
  4. Calcium transport protein 1
  5. ECaC2
  6. Epithelial calcium channel 2
  7. TrpV6
Gene Name TRPV6
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Calcium selective cation channel probably involved in Ca(2+) uptake in various tissues, including Ca(2+) reabsorption in intestine. The channel is activated by low internal calcium level, probably including intracellular calcium store depletion, and the current exhibits an inward rectification. Inactivation includes both, a rapid Ca(2+)-dependent and a slower Ca(2+)-calmodulin- dependent mechanism, the latter may be regulated by phosphorylation. In vitro, is slowly inhibited by Mg(2+) in a voltage-independent manner. Heteromeric assembly with TRPV5 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
Process
establishment of localization
transport
transmembrane transport
ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:7
Locus 7q34
SNPs TRPV6
Gene Sequence
>2178 bp
ATGGGTTTGTCACTGCCCAAGGAGAAAGGGCTAATTCTCTGCCTATGGAGCAAGTTCTGC
AGATGGTTCCAGAGACGGGAGTCCTGGGCCCAGAGCCGAGATGAGCAGGACCTGCTGCAG
CAGAAGAGGATCTGGGAGTCTCCTCTCCTTCTAGCTGCCAAAGATAATGATGTCCAGGCC
CTGAACAAGTTGCTCAAGTATGAGGATTGCAAGGTGCACCATAGAGGAGCCATGGGGGAA
ACAGCGCTACACATAGCAGCCCTCTATGACAACCTGGAGGCCGCCATGGTGCTGATGGAG
GCTGCCCCGGAGCTGGTCTTTGAGCCCATGACATCTGAGCTCTATGAGGGTCAGACTGCA
CTGCACATCGCTGTTGTGAACCAGAACATGAACCTGGTGCGAGCCCTGCTTGCCCGCAGG
GCCAGTGTCTCTGCCAGAGCCACAGGCACTGCCTTCCGCCGTAGTCCCTGCAACCTCATC
TACTTTGGGGAGCACCCTTTGTCCTTTGCTGCCTGTGTGAACAGTGAGGAGATCGTGCGG
CTGCTCATTGAGCATGGAGCTGACATCCGGGCCCAGGACTCCCTGGGAAACACAGTGTTA
CACATCCTCATCCTCCAGCCCAACAAAACCTTTGCCTGCCAGATGTACAACCTGTTGCTG
TCCTACGACAGACATGGGGACCACCTGCAGCCCCTGGACCTCGTGCCCAATCACCAGGGT
CTCACCCCTTTCAAGCTGGCTGGAGTGGAGGGTAACACTGTGATGTTTCAGCACCTGATG
CAGAAGCGGAAGCACACCCAGTGGACGTATGGACCACTGACCTCGACTCTCTATGACCTC
ACAGAGATCGACTCCTCAGGGGATGAGCAGTCCCTGCTGGAACTTATCATCACCACCAAG
AAGCGGGAGGCTCGCCAGATCCTGGACCAGACGCCGGTGAAGGAGCTGGTGAGCCTCAAG
TGGAAGCGGTACGGGCGGCCGTACTTCTGCATGCTGGGTGCCATATATCTGCTGTACATC
ATCTGCTTCACCATGTGCTGCATCTACCGCCCCCTCAAGCCCAGGACCAATAACCGCACG
AGCCCCCGGGACAACACCCTCTTACAGCAGAAGCTACTTCAGGAAGCCTACATGACCCCT
AAGGACGATATCCGGCTGGTCGGGGAGCTGGTGACTGTCATTGGGGCTATCATCATCCTG
CTGGTAGAGGTTCCAGACATCTTCAGAATGGGGGTCACTCGCTTCTTTGGACAGACCATC
CTTGGGGGCCCATTCCATGTCCTCATCATCACCTATGCCTTCATGGTGCTGGTGACCATG
GTGATGCGGCTCATCAGTGCCAGCGGGGAGGTGGTACCCATGTCCTTTGCACTCGTGCTG
GGCTGGTGCAATGTCATGTACTTCGCCCGAGGATTCCAGATGCTAGGCCCCTTCACCATC
ATGATTCAGAAGATGATTTTTGGCGACCTGATGCGATTCTGCTGGCTGATGGCTGTGGTC
ATCCTGGGCTTTGCTTCAGCCTTCTATATCATCTTCCAGACAGAGGACCCCGAGGAGCTA
GGCCACTTCTACGACTACCCCATGGCCCTGTTCAGCACCTTCGAGCTGTTCCTTACCATC
ATCGATGGCCCAGCCAACTACAACGTGGACCTGCCCTTCATGTACAGCATCACCTATGCT
GCCTTTGCCATCATCGCCACACTGCTCATGCTCAACCTCCTCATTGCCATGATGGGCGAC
ACTCACTGGCGAGTGGCCCATGAGCGGGATGAGCTGTGGAGGGCCCAGATTGTGGCCACC
ACGGTGATGCTGGAGCGGAAGCTGCCTCGCTGCCTGTGGCCTCGCTCCGGGATCTGCGGA
CGGGAGTATGGCCTGGGAGACCGCTGGTTCCTGCGGGTGGAAGACAGGCAAGATCTCAAC
CGGCAGCGGATCCAACGCTACGCACAGGCCTTCCACACCCGGGGCTCTGAGGATTTGGAC
AAAGACTCAGTGGAAAAACTAGAGCTGGGCTGTCCCTTCAGCCCCCACCTGTCCCTTCCT
ATGCCCTCAGTGTCTCGAAGTACCTCCCGCAGCAGTGCCAACTGGGAAAGGCTTCGGCAA
GGGACCCTGAGGAGAGACCTGCGTGGGATAATCAACAGGGGTCTGGAGGACGGGGAGAGC
TGGGAATATCAGATCTGA
Protein Properties
Number of Residues 725
Molecular Weight 83209.2
Theoretical pI 7.66
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 329-349
  • 388-408
  • 420-440
  • 449-469
  • 493-513
  • 557-577
Protein Sequence
>Transient receptor potential cation channel subfamily V member 6
MGLSLPKEKGLILCLWSKFCRWFQRRESWAQSRDEQNLLQQKRIWESPLLLAAKDNDVQA
LNKLLKYEDCKVHQRGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTA
LHIAVVNQNMNLVRALLARRASVSARATGTAFRRSPCNLIYFGEHPLSFAACVNSEEIVR
LLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLDLVPNHQG
LTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYDLTEIDSSGDEQSLLELIITTK
KREARQILDQTPVKELVSLKWKRYGRPYFCMLGAIYLLYIICFTMCCIYRPLKPRTNNRT
SPRDNTLLQQKLLQEAYMTPKDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTI
LGGPFHVLIITYAFMVLVTMVMRLISASGEVVPMSFALVLGWCNVMYFARGFQMLGPFTI
MIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEELGHFYDYPMALFSTFELFLTI
IDGPANYNVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQIVAT
TVMLERKLPRCLWPRSGICGREYGLGDRWFLRVEDRQDLNRQRIQRYAQAFHTRGSEDLD
KDSVEKLELGCPFSPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGES
WEYQI
GenBank ID Protein 11935057
UniProtKB/Swiss-Prot ID Q9H1D0
UniProtKB/Swiss-Prot Entry Name TRPV6_HUMAN
PDB IDs Not Available
GenBank Gene ID AF304463
GeneCard ID TRPV6
GenAtlas ID TRPV6
HGNC ID HGNC:14006
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205 ]
  3. Peng JB, Chen XZ, Berger UV, Weremowicz S, Morton CC, Vassilev PM, Brown EM, Hediger MA: Human calcium transport protein CaT1. Biochem Biophys Res Commun. 2000 Nov 19;278(2):326-32. [PubMed:11097838 ]
  4. Wood RJ, Tchack L, Taparia S: 1,25-Dihydroxyvitamin D3 increases the expression of the CaT1 epithelial calcium channel in the Caco-2 human intestinal cell line. BMC Physiol. 2001;1:11. Epub 2001 Aug 17. [PubMed:11545681 ]
  5. Peng JB, Brown EM, Hediger MA: Structural conservation of the genes encoding CaT1, CaT2, and related cation channels. Genomics. 2001 Aug;76(1-3):99-109. [PubMed:11549322 ]
  6. Wissenbach U, Niemeyer BA, Fixemer T, Schneidewind A, Trost C, Cavalie A, Reus K, Meese E, Bonkhoff H, Flockerzi V: Expression of CaT-like, a novel calcium-selective channel, correlates with the malignancy of prostate cancer. J Biol Chem. 2001 Jun 1;276(22):19461-8. Epub 2001 Feb 2. [PubMed:11278579 ]
  7. Niemeyer BA, Bergs C, Wissenbach U, Flockerzi V, Trost C: Competitive regulation of CaT-like-mediated Ca2+ entry by protein kinase C and calmodulin. Proc Natl Acad Sci U S A. 2001 Mar 13;98(6):3600-5. [PubMed:11248124 ]
  8. Bodding M, Flockerzi V: Ca2+ dependence of the Ca2+-selective TRPV6 channel. J Biol Chem. 2004 Aug 27;279(35):36546-52. Epub 2004 Jun 7. [PubMed:15184369 ]