You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02397
Secondary Accession Numbers
  • 7890
Name Solute carrier family 22 member 11
Synonyms
  1. Organic anion transporter 4
Gene Name SLC22A11
Protein Type Transporter
Biological Properties
General Function Involved in transporter activity
Specific Function Mediates saturable uptake of estrone sulfate, dehydroepiandrosterone sulfate and related compounds
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13.1
SNPs SLC22A11
Gene Sequence
>1653 bp
ATGGCGTTCTCGAAGCTCTTGGAGCAAGCCGGAGGCGTGGGCCTCTTCCAGACCCTGCAG
GTGCTCACCTTCATCCTCCCCTGCCTCATGATACCTTCCCAGATGCTCCTGGAGAACTTC
TCAGCCGCCATCCCAGGCCACCGATGCTGGACACACATGCTGGACAATGGCTCTGCGGTT
TCCACAAACATGACCCCCAAGGCCCTTCTGACCATCTCCATCCCGCCAGGCCCCAACCAG
GGGCCCCACCAGTGCCGCCGCTTCCGCCAGCCACAGTGGCAGCTCTTGGACCCCAATGCC
ACGGCCACCAGCTGGAGCGAAGCTGACACGGAGCCGTGTGTGGACGGCTGGGTCTATGAC
CGCAGCGTCTTCACCTCCACCATCGTGGCCAAGTGGGACCTGGTGTGCAGCTCCCAGGGC
TTGAAGCCCCTAAGCCAGTCCATCTTCATGTCCGGGATCCTGGTGGGCTCCTTTATCTGG
GGCCTCCTCTCCTACCGGTTTGGGAGGAAGCCGATGCTGAGCTGGTGCTGCCTGCAGTTG
GCCGTGGCGGGCACCAGCACCATCTTCGCCCCAACATTCGTCATCTACTGCGGCCTGCGG
TTCGTGGCCGCTTTTGGGATGGCCGGCATCTTTCTGAGTTCACTGACACTGATGGTGGAG
TGGACCACGACCAGCAGGAGGGCGGTCACCATGACGGTGGTGGGATGTGCCTTCAGCGCA
GGCCAGGCGGCGCTGGGCGGCCTGGCCTTTGCCCTGCGGGACTGGAGGACTCTCCAGCTG
GCAGCATCAGTGCCCTTCTTTGCCATCTCCCTGATATCCTGGTGGCTGCCAGAATCCGCC
CGGTGGCTGATTATTAAGGGCAAACCAGACCAAGCACTTCAGGAGCTCAGAAAGGTGGCC
AGGATAAATGGCCACAAGGAGGCCAAGAACCTGACCATAGAGGTGCTGATGTCCAGCGTG
AAGGAGGAGGTGGCCTCTGCAAAGGAGCCGCGGTCGGTGCTGGACCTGTTCTGCGTGCCC
GTGCTCCGCTGGAGGAGCTGCGCCATGCTGGTGGTGAATTTCTCTCTATTGATCTCCTAC
TATGGGCTGGTCTTCGACCTGCAGAGCCTGGGCCGTGACATCTTCCTCCTCCAGGCCCTC
TTCGGGGCCGTGGACTTCCTGGGCCGGGCCACCACTGCCCTCTTGCTCAGTTTCCTTGGC
CGCCGCACCATCCAGGCGGGTTCCCAGGCCATGGCCGGCCTCGCCATTCTAGCCAACATG
CTGGTGCCGCAAGATTTGCAGACCCTGCGTGTGGTCTTTGCTGTGCTGGGAAAGGGATGT
TTTGGGATAAGCCTAACCTGCCTCACCATCTACAAGGCTGAACTCTTTCCAACGCCAGTG
CGGATGACAGCAGATGGCATTCTGCATACAGTGGGCCGGCTGGGGGCTATGATGGGTCCC
CTGATCCTGATGAGCCGCCAAGCCCTGCCCCTGCTGCCTCCTCTCCTCTATGGCGTTATC
TCCATTGCTTCCAGCCTGGTTGTGCTGTTCTTCCTCCCGGAGACCCAGGGACTTCCGCTC
CCTGACACTATCCAGGACCTGGAGAGCCAGAAATCAACAGCAGCCCAGGGCAACCGGCAA
GAGGCCGTCACTGTGGAAAGTACCTCGCTCTAG
Protein Properties
Number of Residues 550
Molecular Weight 59970.9
Theoretical pI 8.71
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 11-31
  • 143-163
  • 175-195
  • 201-221
  • 232-252
  • 257-277
  • 347-367
  • 379-399
  • 403-423
  • 431-451
  • 464-484
  • 491-511
Protein Sequence
>Solute carrier family 22 member 11
MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCWTHMLDNGSAV
STNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYD
RSVFTSTIVAKWDLVCSSQGLKPLSQSIFMSGILVGSFIWGLLSYRFGRKPMLSWCCLQL
AVAGTSTIFAPTFVIYCGLRFVAAFGMAGIFLSSLTLMVEWTTTSRRAVTMTVVGCAFSA
GQAALGGLAFALRDWRTLQLAASVPFFAISLISWWLPESARWLIIKGKPDQALQELRKVA
RINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPVLRWRSCAMLVVNFSLLISY
YGLVFDLQSLGRDIFLLQALFGAVDFLGRATTALLLSFLGRRTIQAGSQAMAGLAILANM
LVPQDLQTLRVVFAVLGKGCFGISLTCLTIYKAELFPTPVRMTADGILHTVGRLGAMMGP
LILMSRQALPLLPPLLYGVISIASSLVVLFFLPETQGLPLPDTIQDLESQKSTAAQGNRQ
EAVTVESTSL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NSA0
UniProtKB/Swiss-Prot Entry Name S22AB_HUMAN
PDB IDs Not Available
GenBank Gene ID AB026116
GeneCard ID SLC22A11
GenAtlas ID SLC22A11
HGNC ID HGNC:18120
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  4. Cha SH, Sekine T, Kusuhara H, Yu E, Kim JY, Kim DK, Sugiyama Y, Kanai Y, Endou H: Molecular cloning and characterization of multispecific organic anion transporter 4 expressed in the placenta. J Biol Chem. 2000 Feb 11;275(6):4507-12. [PubMed:10660625 ]
  5. Zhou F, Pan Z, Ma J, You G: Mutational analysis of histidine residues in human organic anion transporter 4 (hOAT4). Biochem J. 2004 Nov 15;384(Pt 1):87-92. [PubMed:15291761 ]
  6. Zhou F, Tanaka K, Pan Z, Ma J, You G: The role of glycine residues in the function of human organic anion transporter 4. Mol Pharmacol. 2004 May;65(5):1141-7. [PubMed:15102942 ]
  7. Zhou F, Xu W, Hong M, Pan Z, Sinko PJ, Ma J, You G: The role of N-linked glycosylation in protein folding, membrane targeting, and substrate binding of human organic anion transporter hOAT4. Mol Pharmacol. 2005 Mar;67(3):868-76. Epub 2004 Dec 2. [PubMed:15576633 ]