You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02412
Secondary Accession Numbers
  • 7905
Name T-cell surface glycoprotein CD1e, membrane-associated
Synonyms
  1. CD1e antigen
  2. R2G1
  3. T-cell surface glycoprotein CD1e, soluble
  4. hCD1e
  5. sCD1e
Gene Name CD1E
Protein Type Enzyme
Biological Properties
General Function Involved in immune response
Specific Function T-cell surface glycoprotein CD1e, soluble is required for the presentation of glycolipid antigens on the cell surface. The membrane-associated form is not active
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Process
antigen processing and presentation
immune system process
immune response
Cellular Location
  1. T-cell surface glycoprotein CD1e
  2. soluble:Lysosome lumen
Gene Properties
Chromosome Location Chromosome:1
Locus 1q22-q23
SNPs CD1E
Gene Sequence
>1164 bp
ATGCTGCTCCTGTTCCTCCTCTTCGAGGGTCTCTGCTGTCCTGGGGAAAATACAGCAGCT
CCCCAGGCTCTACAATCCTATCATCTAGCAGCAGAGGAGCAGCTGTCCTTCCGCATGCTC
CAAACTTCCTCCTTTGCCAACCACAGCTGGGCACACAGTGAGGGCTCAGGATGGCTGGGT
GACCTGCAGACTCATGGCTGGGACACTGTCTTGGGCACCATCCGCTTTCTGAAGCCCTGG
TCCCATGGAAACTTCAGCAAGCAGGAGCTGAAAAACTTACAGTCACTGTTCCAGTTATAC
TTCCATAGTTTTATCCGGATAGTGCAAGCTTCTGCTGGTCAATTTCAGCTTGAATACCCC
TTCGAGATCCAGATATTAGCTGGCTGTAGAATGAATGCCCCACAAATCTTCTTAAATATG
GCATATCAAGGGTCAGATTTCCTGAGTTTCCAAGGAATTTCCTGGGAGCCATCTCCAGGA
GCAGGGATCCGGGCCCAGAACATCTGTAAAGTGCTCAATCGCTACCTAGATATTAAGGAA
ATACTGCAAAGCCTTCTTGGTCACACCTGCCCTCGATTTCTAGCGGGGCTCATGGAAGCA
GGGGAGTCAGAACTGAAACGGAAAGTGAAGCCAGAGGCCTGGCTGTCCTGTGGCCCCAGT
CCTGGCCCTGGCCGTCTGCAGCTTGTGTGCCATGTCTCAGGATTCTACCCAAAGCCCGTG
TGGGTGATGTGGATGCGGGGTGAGCAGGAGCAGCGGGGCACTCAGCGAGGGGACGTCCTG
CCTAATGCTGACGAGACATGGTATCTCCGAGCAACCCTGGATGTGGCGGCTGGGGAGGCA
GCTGGCCTGTCCTGTCGGGTGAAACACAGCAGTCTAGGGGGCCATGATCTAATCATCCAT
TGGGGTGGATATTCCATCTTTCTCATCCTGATCTGTTTGACTGTGATAGTTACCCTGGTC
ATATTGGTTGTAGTTGACTCACGGTTAAAAAAACAGAGTTCAAATAAGAACATTCTTTCT
CCCCACACACCCAGCCCTGTCTTTCTCATGGGAGCCAACACTCAGGACACCAAGAATTCA
AGACATCAGTTCTGCTTGGCACAAGTATCGTGGATCAAAAACAGAGTATTGAAGAAGTGG
AAGACACGCCTAAACCAACTCTGG
Protein Properties
Number of Residues 388
Molecular Weight 43626.1
Theoretical pI 8.69
Pfam Domain Function
Signals
  • 1-19
Transmembrane Regions
  • 305-325
Protein Sequence
>T-cell surface glycoprotein CD1e, membrane-associated
MLLLFLLFEGLCCPGENTAAPQALQSYHLAAEEQLSFRMLQTSSFANHSWAHSEGSGWLG
DLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLEYP
FEIQILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNICKVLNRYLDIKE
ILQSLLGHTCPRFLAGLMEAGESELKRKVKPEAWLSCGPSPGPGRLQLVCHVSGFYPKPV
WVMWMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEAAGLSCRVKHSSLGGHDLIIH
WGGYSIFLILICLTVIVTLVILVVVDSRLKKQSSNKNILSPHTPSPVFLMGANTQDTKNS
RHQFCLAQVSWIKNRVLKKWKTRLNQLW
GenBank ID Protein 8249469
UniProtKB/Swiss-Prot ID P15812
UniProtKB/Swiss-Prot Entry Name CD1E_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ289111
GeneCard ID CD1E
GenAtlas ID CD1E
HGNC ID HGNC:1638
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Calabi F, Jarvis JM, Martin L, Milstein C: Two classes of CD1 genes. Eur J Immunol. 1989 Feb;19(2):285-92. [PubMed:2467814 ]
  4. Angenieux C, Salamero J, Fricker D, Cazenave JP, Goud B, Hanau D, de La Salle H: Characterization of CD1e, a third type of CD1 molecule expressed in dendritic cells. J Biol Chem. 2000 Dec 1;275(48):37757-64. [PubMed:10948205 ]
  5. Han M, Hannick LI, DiBrino M, Robinson MA: Polymorphism of human CD1 genes. Tissue Antigens. 1999 Aug;54(2):122-7. [PubMed:10488738 ]
  6. Tamouza R, Sghiri R, Ramasawmy R, Neonato MG, Mombo LE, Poirier JC, Schaeffer V, Fortier C, Labie D, Girot R, Toubert A, Krishnamoorthy R, Charron D: Two novel CD1 E alleles identified in black African individuals. Tissue Antigens. 2002 May;59(5):417-20. [PubMed:12144626 ]
  7. Mirones I, Oteo M, Parra-Cuadrado JF, Martinez-Naves E: Identification of two novel human CD1E alleles. Tissue Antigens. 2000 Aug;56(2):159-61. [PubMed:11019917 ]
  8. Martin LH, Calabi F, Milstein C: Isolation of CD1 genes: a family of major histocompatibility complex-related differentiation antigens. Proc Natl Acad Sci U S A. 1986 Dec;83(23):9154-8. [PubMed:3097645 ]
  9. de la Salle H, Mariotti S, Angenieux C, Gilleron M, Garcia-Alles LF, Malm D, Berg T, Paoletti S, Maitre B, Mourey L, Salamero J, Cazenave JP, Hanau D, Mori L, Puzo G, De Libero G: Assistance of microbial glycolipid antigen processing by CD1e. Science. 2005 Nov 25;310(5752):1321-4. [PubMed:16311334 ]
  10. Maitre B, Angenieux C, Salamero J, Hanau D, Fricker D, Signorino F, Proamer F, Cazenave JP, Goud B, Tourne S, de la Salle H: Control of the intracellular pathway of CD1e. Traffic. 2008 Apr;9(4):431-45. doi: 10.1111/j.1600-0854.2008.00707.x. Epub 2008 Jan 15. [PubMed:18208508 ]
  11. Maitre B, Angenieux C, Wurtz V, Layre E, Gilleron M, Collmann A, Mariotti S, Mori L, Fricker D, Cazenave JP, van Dorsselaer A, Gachet C, de Libero G, Puzo G, Hanau D, de la Salle H: The assembly of CD1e is controlled by an N-terminal propeptide which is processed in endosomal compartments. Biochem J. 2009 May 1;419(3):661-8. doi: 10.1042/BJ20082204. [PubMed:19196239 ]
  12. Tourne S, Maitre B, Collmann A, Layre E, Mariotti S, Signorino-Gelo F, Loch C, Salamero J, Gilleron M, Angenieux C, Cazenave JP, Mori L, Hanau D, Puzo G, De Libero G, de la Salle H: Cutting edge: a naturally occurring mutation in CD1e impairs lipid antigen presentation. J Immunol. 2008 Mar 15;180(6):3642-6. [PubMed:18325888 ]