You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02483
Secondary Accession Numbers
  • 7978
Name Folate transporter 1
Synonyms
  1. FOLT
  2. IFC-1
  3. Intestinal folate carrier 1
  4. Placental folate transporter
  5. RFC
  6. Reduced folate carrier protein
  7. Solute carrier family 19 member 1
Gene Name SLC19A1
Protein Type Enzyme
Biological Properties
General Function Involved in folic acid binding
Specific Function Transporter for the intake of folate. Uptake of folate in human placental choriocarcinoma cells occurs by a novel mechanism called potocytosis which functionally couples three components, namely the folate receptor, the folate transporter, and a V-type H(+)-pump.
Pathways
  • Vitamin digestion and absorption
Reactions Not Available
GO Classification
Biological Process
folic acid metabolic process
Cellular Component
integral to plasma membrane
Component
membrane
cell part
Function
active transmembrane transporter activity
binding
transmembrane transporter activity
folic acid binding
carboxylic acid binding
amino acid binding
transporter activity
secondary active transmembrane transporter activity
reduced folate carrier activity
Molecular Function
methotrexate transporter activity
folic acid transporter activity
folic acid binding
reduced folate carrier activity
Process
establishment of localization
transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 21
Locus 21q22.3
SNPs SLC19A1
Gene Sequence
>1776 bp
ATGGTGCCCTCCAGCCCAGCGGTGGAGAAGCAGGTGCCCGTGGAACCTGGGCCTGACCCC
GAGCTCCGGTCCTGGCGGCACCTCGTGTGCTACCTTTGCTTCTACGGCTTCATGGCGCAG
ATACGGCCAGGGGAGAGCTTCATCACCCCCTACCTCCTGGGGCCCGACAAGAACTTCACG
CGGGAGCAGGTCACGAACGAGATCACGCCGGTGTTGTCGTACTCCTACCTGGCCGTGCTG
GTGCCCGTGTTCCTGCTCACCGACTACCTGCGCTACACGCCGGTGCTGCTGCTGCAGGGG
CTCAGCTTCGTGTCGGTGTGGCTGCTGCTGCTGCTGGGCCACTCGGTGGCGCACATGCAG
CTCATGGAGCTCTTCTACAGCGTCACCATGGCCGCGCGCATCGCCTATTCCTCCTACATC
TTCTCTCTCGTGCGGCCCGCGCGCTACCAGCGTGTGGCCGGCTACTCGCGCGCTGCGGTG
CTGCTGGGCGTGTTCACCAGCTCCGTGCTGGGCCAGCTGCTGGTCACTGTGGGCCGAGTC
TCCTTCTCCACGCTCAACTACATCTCGCTGGCCTTCCTCACCTTCAGCGTGGTCCTCGCC
CTCTTCCTGAAGCGCCCCAAGCGCAGCCTCTTCTTCAACCGCGACGACCGGGGGCGGTGC
GAAACCTCGGCTTCGGAGCTGGAGCGCATGAATCCCGGCCCAGGCGGGAAGCTGGGACAC
GCCCTGCGGGTGGCCTGTGGGGACTCAGTGCTGGCGCGGATGCTGCGGGAGCTGGGGGAC
AGCCTGCGGCGGCCGCAGCTGCGCCTGTGGTCCCTCTGGTGGGTCTTCAACTCGGCCGGC
TACTACCTGGTGGTCTACTACGTGCACATCCTGTGGAACGAGGTGGACCCCACCACCAAC
AGTGCGCGGGTCTACAACGGCGCGGCAGATGCTGCCTCCACGCTGCTGGGCGCCATCACG
TCCTTCGCCGCGGGCTTCGTGAAGATCCGCTGGGCGCGCTGGTCCAAGCTGCTCATCGCG
GGCGTCACGGCCACGCAGGCGGGGCTGGTCTTCCTTCTGGCGCACACGCGCCACCCGAGC
AGCATCTGGCTGTGCTATGCGGCCTTCGTGCTGTTCCGCGGCTCCTACCAGTTCCTCGTG
CCCATCGCCACCTTTCAGATTGCATCTTCTCTGTCTAAAGAGCTCTGTGCCCTGGTCTTC
GGGGTCAACACGTTCTTTGCCACCATCGTCAAGACCATCATCACTTTCATTGTCTCGGAC
GTGCGGGGCCTGGGCCTCCCGGTCCGCAAGCAGTTCCAGTTATACTCCGTGTACTTCCTG
ATCCTGTCCATCATCTACTTCTTGGGGGCCATGCTGGATGGCCTGCGGCACTGCCAGCGG
GGCCACCACCCGCGGCAGCCCCCGGCCCAGGGCCTGAGGAGTGCCGCGGAGGAGAAGGCA
GCACAGGCACTGAGCGTGCAGGACAAGGGCCTCGGAGGCCTGCAGCCAGCCCAGAGCCCG
CCGCTTTCCCCAGAAGACAGCCTGGGGGCTGTGGGGCCAGCCTCCCTGGAGCAGAGACAG
AGCGACCCATACCTGGCCCAGGCCCCGGCCCCGCAGGCAGCTGAATTCCTGAGCCCAGTG
ACAACCCCTTCCCCCTGCACTCTGTGCTCCGCCCAAGCCTCAGGCCCTGAGGCTGCAGAT
GAGACTTGTCCCCAGCTGGCTGTCCATCCTCCTGGTGTCAGCAAGCTGGGTTTGCAGTGT
CTTCCAAGCGACGGTGTTCAGAATGTGAACCAGTGA
Protein Properties
Number of Residues 591
Molecular Weight 54261.68
Theoretical pI 9.514
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Folate transporter 1
MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFT
REQVTNEITPVLSYSYLAVLVPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQ
LMELFYSVTMAARIAYSSYIFSLVRPARYQRVAGYSRAAVLLGVFTSSVLGQLLVTVGRV
SFSTLNYISLAFLTFSVVLALFLKRPKRSLFFNRDDRGRCETSASELERMNPGPGGKLGH
ALRVACGDSVLARMLRELGDSLRRPQLRLWSLWWVFNSAGYYLVVYYVHILWNEVDPTTN
SARVYNGAADAASTLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLVFLLAHTRHPS
SIWLCYAAFVLFRGSYQFLVPIATFQIASSLSKELCALVFGVNTFFATIVKTIITFIVSD
VRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKA
AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPV
TTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ
GenBank ID Protein 2209135
UniProtKB/Swiss-Prot ID P41440
UniProtKB/Swiss-Prot Entry Name S19A1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF004354
GeneCard ID SLC19A1
GenAtlas ID SLC19A1
HGNC ID HGNC:10937
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Hattori M, Fujiyama A, Taylor TD, Watanabe H, Yada T, Park HS, Toyoda A, Ishii K, Totoki Y, Choi DK, Groner Y, Soeda E, Ohki M, Takagi T, Sakaki Y, Taudien S, Blechschmidt K, Polley A, Menzel U, Delabar J, Kumpf K, Lehmann R, Patterson D, Reichwald K, Rump A, Schillhabel M, Schudy A, Zimmermann W, Rosenthal A, Kudoh J, Schibuya K, Kawasaki K, Asakawa S, Shintani A, Sasaki T, Nagamine K, Mitsuyama S, Antonarakis SE, Minoshima S, Shimizu N, Nordsiek G, Hornischer K, Brant P, Scharfe M, Schon O, Desario A, Reichelt J, Kauer G, Blocker H, Ramser J, Beck A, Klages S, Hennig S, Riesselmann L, Dagand E, Haaf T, Wehrmeyer S, Borzym K, Gardiner K, Nizetic D, Francis F, Lehrach H, Reinhardt R, Yaspo ML: The DNA sequence of human chromosome 21. Nature. 2000 May 18;405(6784):311-9. [PubMed:10830953 ]
  5. Prasad PD, Ramamoorthy S, Leibach FH, Ganapathy V: Molecular cloning of the human placental folate transporter. Biochem Biophys Res Commun. 1995 Jan 17;206(2):681-7. [PubMed:7826387 ]
  6. Wong SC, Proefke SA, Bhushan A, Matherly LH: Isolation of human cDNAs that restore methotrexate sensitivity and reduced folate carrier activity in methotrexate transport-defective Chinese hamster ovary cells. J Biol Chem. 1995 Jul 21;270(29):17468-75. [PubMed:7615551 ]
  7. Moscow JA, Gong M, He R, Sgagias MK, Dixon KH, Anzick SL, Meltzer PS, Cowan KH: Isolation of a gene encoding a human reduced folate carrier (RFC1) and analysis of its expression in transport-deficient, methotrexate-resistant human breast cancer cells. Cancer Res. 1995 Sep 1;55(17):3790-4. [PubMed:7641195 ]
  8. Williams FM, Flintoff WF: Isolation of a human cDNA that complements a mutant hamster cell defective in methotrexate uptake. J Biol Chem. 1995 Feb 17;270(7):2987-92. [PubMed:7852378 ]
  9. Nguyen TT, Dyer DL, Dunning DD, Rubin SA, Grant KE, Said HM: Human intestinal folate transport: cloning, expression, and distribution of complementary RNA. Gastroenterology. 1997 Mar;112(3):783-91. [PubMed:9041240 ]
  10. Ferguson PL, Flintoff WF: Topological and functional analysis of the human reduced folate carrier by hemagglutinin epitope insertion. J Biol Chem. 1999 Jun 4;274(23):16269-78. [PubMed:10347183 ]