You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02521
Secondary Accession Numbers
  • 8017
  • HMDBP06085
Name Urea transporter 2
Synonyms
  1. Solute carrier family 14 member 2
  2. Urea transporter, kidney
Gene Name SLC14A2
Protein Type Transporter
Biological Properties
General Function Involved in urea transmembrane transporter activity
Specific Function Specialized low-affinity vasopressin-regulated urea transporter. Mediates rapid transepithelial urea transport across the inner medullary collecting duct and plays a major role in the urinary concentrating mechanism.
Pathways
  • Amiloride Action Pathway
  • Bendroflumethiazide Action Pathway
  • Blue diaper syndrome
  • Bumetanide Action Pathway
  • Chlorothiazide Action Pathway
  • Chlorthalidone Action Pathway
  • Cyclothiazide Action Pathway
  • Cystinuria
  • Eplerenone Action Pathway
  • Ethacrynic Acid Action Pathway
  • Furosemide Action Pathway
  • Glucose Transporter Defect (SGLT2)
  • Glucose Transporter Defect (SGLT2)
  • Hartnup Disorder
  • Hydrochlorothiazide Action Pathway
  • Hydroflumethiazide Action Pathway
  • Iminoglycinuria
  • Indapamide Action Pathway
  • Kidney Function
  • Lysinuric Protein Intolerance
  • Lysinuric protein intolerance (LPI)
  • Methyclothiazide Action Pathway
  • Metolazone Action Pathway
  • Polythiazide Action Pathway
  • Quinethazone Action Pathway
  • Spironolactone Action Pathway
  • Torsemide Action Pathway
  • Triamterene Action Pathway
  • Trichlormethiazide Action Pathway
Reactions Not Available
GO Classification
Biological Process
ammonium transmembrane transport
Cellular Component
plasma membrane
apical plasma membrane
integral to membrane
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
urea transmembrane transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
transporter activity
amide transmembrane transporter activity
Molecular Function
urea transmembrane transporter activity
ammonium transmembrane transporter activity
Process
amide transport
urea transport
establishment of localization
transport
Cellular Location
  1. Multi-pass membrane protein
  2. Apical cell membrane
Gene Properties
Chromosome Location 18
Locus 18q12.1-q21.1
SNPs SLC14A2
Gene Sequence
>2763 bp
ATGTCTGACCCCCACAGCAGTCCTCTCCTGCCAGAGCCACTTTCCAGCAGATACAAACTC
TACGAGGCAGAGTTTACCAGCCCGAGCTGGCCCTCGACATCCCCGGATACTCACCCAGCT
CTGCCCCTCCTGGAAATGCCTGAAGAAAAGGATCTCCGGTCTTCCAATGAAGACAGTCAC
ATTGTGAAGATCGAAAAGCTCAATGAAAGGAGTAAAAGGAAAGACGACGGGGTGGCCCAT
CGGGACTCAGCAGGCCAAAGGTGCATCTGCCTCTCCAAAGCAGTGGGCTACCTCACGGGC
GACATGAAGGAGTACAGGATCTGGCTGAAAGACAAGCACCTTGCCCTCCAGTTCATAGAC
TGGGTCCTGAGAGGGACCGCTCAGGTGATGTTCATCAACAATCCTCTCAGCGGCCTCATC
ATCTTCATAGGGCTGCTGATCCAGAATCCCTGGTGGACAATCACTGGGGGCCTGGGGACA
GTGGTCTCGACCTTAACAGCTCTCGCCTTGGGCCAAGACAGGTCTGCCATTGCCTCAGGA
CTCCATGGGTACAACGGGATGCTGGTGGGACTGCTGATGGCCGTGTTCTCGGAGAAGTTA
GACTACTACTGGTGGCTTCTGTTTCCTGTGACCTTCACAGCCATGTCCTGCCCAGTTCTT
TCTAGTGCCTTGAATTCCATCTTCAGCAAGTGGGACCTCCCGGTCTTCACTCTGCCCTTC
AACATTGCAGTCACCTTGTACCTTGCAGCCACAGGCCACTACAACCTCTTCTTCCCCACA
ACACTGGTAGAGCCTGTGTCTTCAGTGCCCAATATCACCTGGACAGAGATGGAAATGCCC
CTGCTGTTACAAGCCATCCCTGTTGGGGTCGGCCAGGTGTATGGCTGTGACAATCCCTGG
ACAGGCGGCGTGTTCCTGGTGGCTCTGTTCATCTCCTCGCCACTCATCTGCTTGCATGCA
GCCATTGGCTCAATCGTGGGGCTGCTAGCAGCCCTGTCAGTGGCCACACCCTTCGAGACC
ATCTACACAGGCCTCTGGAGCTACAACTGCGTCCTCTCCTGCATCGCCATCGGAGGCATG
TTCTATGCCCTCACCTGGCAGACTCACCTGCTGGCCCTCATCTGTGCCCTGTTCTGTGCA
TACATGGAAGCAGCCATCTCCAACATCATGTCAGTGGTGGGCGTGCCACCAGGCACCTGG
GCCTTCTGCCTTGCCACCATCATCTTCCTGCTCCTGACGACAAACAACCCAGCCATCTTC
AGACTCCCACTCAGCAAAGTCACCTACCCCGAGGCCAACCGCATCTACTACCTGACAGTG
AAAAGCGGTGAAGAAGAGAAGGCCCCCAGCGGAGGCGGTGGGGAGCATCCACCCACAGCA
GGCCCAAAGGTGGAGGAGGGCTCGGAGGCTGTGCTCTCCAAGCACAGGAGTGTATTTCAC
ATCGAGTGGTCATCCATTCGGAGGAGGAGCAAAGTGTTTGGAAAAGGCGAACACCAGGAA
AGACAAAACAAAGACCCATTTCCCTATCGATACCGGAAGCCCACAGTCGAGCTGCTTGAT
CTGGACACCATGGAGGAGAGCTCTGAGATAAAAGTGGAAACAAACATTTCCAAGACATCC
TGGATTCGGAGTTCCATGGCTGCCAGTGGGAAAAGGGTCAGCAAAGCCCTCAGCTACATC
ACAGGAGAGATGAAGGAGTGTGGAGAGGGACTTAAAGACAAGTCCCCAGTGTTCCAGTTC
TTTGACTGGGTCCTCCGAGGCACATCTCAAGTGATGTTTGTGAACAACCCCCTCAGCGGC
ATCCTCATCATCCTCGGCCTCTTCATCCAGAACCCCTGGTGGGCGATCTCAGGCTGCCTG
GGTACCATCATGTCCACCTTGACAGCCCTCATCCTGAGTCAGGACAAGTCGGCCATCGCT
GCAGGATTTCACGGCTACAATGGGGTGCTGGTGGGGCTGCTGATGGCCGTGTTCTCAGAC
AAAGGTGACTACTACTGGTGGCTGTTGCTACCCGTCATCATCATGTCCATGTCTTGCCCC
ATCCTCTCCAGTGCCCTGGGTACCATCTTCAGCAAGTGGGACCTCCCAGTCTTCACACTG
CCCTTCAATATCACTGTGACTTTGTACCTGGCAGCCACGGGCCACTACAACCTTTTCTTC
CCCACAACGCTGCTGCAGCCTGCATCCGCCATGCCCAACATCACCTGGTCAGAGGTCCAA
GTGCCCTTGCTTTTGAGAGCCATCCCCGTTGGAATTGGCCAAGTGTACGGCTGTGATAAC
CCCTGGACTGGAGGCATCTTCCTCATAGCTCTGTTCATATCCTCACCTCTCATTTGCTTG
CATGCAGCAATTGGATCCACCATGGGGATGCTAGCAGCACTCACTATTGCGACGCCCTTT
GACTCCATCTACTTCGGCCTGTGTGGCTTCAACAGCACCCTCGCATGCATAGCGATAGGA
GGCATGTTCTACGTCATCACCTGGCAGACGCACCTCCTCGCCATCGCCTGCGCACTGTTT
GCTGCCTACCTGGGTGCTGCCCTGGCTAACATGTTATCTGTGTTTGGATTGCCGCCCTGC
ACTTGGCCCTTCTGTCTCTCAGCTCTCACCTTCCTGCTCCTGACGACCAATAACCCCGCC
ATCTACAAGCTCCCGCTCAGCAAAGTCACCTACCCAGAGGCCAACCGCATCTACTACCTG
TCCCAGGAGAGAAACAGAAGGGCATCAATCATAACAAAGTATCAGGCCTACGATGTCTCC
TAA
Protein Properties
Number of Residues 920
Molecular Weight 101207.965
Theoretical pI 6.944
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Urea transporter 2
MSDPHSSPLLPEPLSSRYKLYEAEFTSPSWPSTSPDTHPALPLLEMPEEKDLRSSNEDSH
IVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFID
WVLRGTAQVMFINNPLSGLIIFIGLLIQNPWWTITGGLGTVVSTLTALALGQDRSAIASG
LHGYNGMLVGLLMAVFSEKLDYYWWLLFPVTFTAMSCPVLSSALNSIFSKWDLPVFTLPF
NIAVTLYLAATGHYNLFFPTTLVEPVSSVPNITWTEMEMPLLLQAIPVGVGQVYGCDNPW
TGGVFLVALFISSPLICLHAAIGSIVGLLAALSVATPFETIYTGLWSYNCVLSCIAIGGM
FYALTWQTHLLALICALFCAYMEAAISNIMSVVGVPPGTWAFCLATIIFLLLTTNNPAIF
RLPLSKVTYPEANRIYYLTVKSGEEEKAPSGGGGEHPPTAGPKVEEGSEAVLSKHRSVFH
IEWSSIRRRSKVFGKGEHQERQNKDPFPYRYRKPTVELLDLDTMEESSEIKVETNISKTS
WIRSSMAASGKRVSKALSYITGEMKECGEGLKDKSPVFQFFDWVLRGTSQVMFVNNPLSG
ILIILGLFIQNPWWAISGCLGTIMSTLTALILSQDKSAIAAGFHGYNGVLVGLLMAVFSD
KGDYYWWLLLPVIIMSMSCPILSSALGTIFSKWDLPVFTLPFNITVTLYLAATGHYNLFF
PTTLLQPASAMPNITWSEVQVPLLLRAIPVGIGQVYGCDNPWTGGIFLIALFISSPLICL
HAAIGSTMGMLAALTIATPFDSIYFGLCGFNSTLACIAIGGMFYVITWQTHLLAIACALF
AAYLGAALANMLSVFGLPPCTWPFCLSALTFLLLTTNNPAIYKLPLSKVTYPEANRIYYL
SQERNRRASIITKYQAYDVS
GenBank ID Protein 157694503
UniProtKB/Swiss-Prot ID Q15849
UniProtKB/Swiss-Prot Entry Name UT2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_007163.3
GeneCard ID SLC14A2
GenAtlas ID SLC14A2
HGNC ID HGNC:10919
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. [PubMed:16177791 ]
  4. Olives B, Martial S, Mattei MG, Matassi G, Rousselet G, Ripoche P, Cartron JP, Bailly P: Molecular characterization of a new urea transporter in the human kidney. FEBS Lett. 1996 May 20;386(2-3):156-60. [PubMed:8647271 ]
  5. Bagnasco SM, Peng T, Janech MG, Karakashian A, Sands JM: Cloning and characterization of the human urea transporter UT-A1 and mapping of the human Slc14a2 gene. Am J Physiol Renal Physiol. 2001 Sep;281(3):F400-6. [PubMed:11502588 ]
  6. Mistry AC, Mallick R, Frohlich O, Klein JD, Rehm A, Chen G, Sands JM: The UT-A1 urea transporter interacts with snapin, a SNARE-associated protein. J Biol Chem. 2007 Oct 12;282(41):30097-106. Epub 2007 Aug 16. [PubMed:17702749 ]