You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02528
Secondary Accession Numbers
  • 8026
Name Transcription factor NF-E2 45 kDa subunit
Synonyms
  1. Leucine zipper protein NF-E2
  2. Nuclear factor, erythroid-derived 2 45 kDa subunit
  3. p45 NF-E2
Gene Name NFE2
Protein Type Unknown
Biological Properties
General Function Involved in sequence-specific DNA binding transcription factor activity
Specific Function Component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation. Binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. Requires MAFK or other small MAF proteins for binding to the NF-E2 motif. May play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
nucleic acid binding
dna binding
protein dimerization activity
sequence-specific dna binding
sequence-specific dna binding transcription factor activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. PML body
Gene Properties
Chromosome Location Chromosome:1
Locus 12q13
SNPs NFE2
Gene Sequence
>1122 bp
ATGTCCCCGTGTCCTCCCCAGCAGAGCAGGAACAGGGTGATACAGCTGTCCACTTCAGAG
CTAGGAGAGATGGAACTGACTTGGCAGGAGATCATGTCCATCACCGAGCTGCAGGGTCTG
AATGCTCCAAGTGAGCCATCATTTGAGCCCCAAGCCCCAGCTCCATACCTTGGACCTCCA
CCACCCACAACTTACTGCCCCTGCTCAATCCACCCAGATTCTGGCTTCCCACTTCCTCCA
CCACCTTATGAGCTCCCAGCATCCACATCCCATGTCCCAGATCCCCCATACTCCTATGGC
AACATGGCCATACCAGTCTCCAAGCCACTGAGCCTCTCAGGCCTGCTCAGTGAGCCGCTC
CAAGACCCCTTAGCCCTCCTGGACATTGGGCTGCCAGCAGGGCCACCTAAGCCCCAAGAA
GACCCAGAATCCGACTCAGGATTATCCCTCAACTATAGCGATGCTGAATCTCTTGAGCTG
GAGGGGACAGAGGCTGGTCGGCGGCGCAGCGAATATGTAGAGATGTACCCAGTGGAGTAC
CCCTACTCACTCATGCCCAACTCCTTGGCCCACTCCAACTATACCTTGCCAGCTGCTGAG
ACCCCCTTGGCCTTAGAGCCCTCCTCAGGCCCTGTGCGGGCTAAGCCCACTGCACGGGGG
GAGGCAGGGAGTCGGGATGAACGTCGGGCCTTGGCCATGAAGATTCCTTTTCCTACGGAC
AAGATTGTCAACTTGCCGGTAGATGACTTTAATGAGCTATTGGCAAGGTACCCGCTGACA
GAGAGCCAGCTAGCGCTAGTCCGGGACATCCGACGACGGGGCAAAAACAAGGTGGCAGCC
CAGAACTGCCGCAAGAGGAAGCTGGAAACCATTGTGCAGCTGGAGCGGGAGCTGGAGCGG
CTGACCAATGAACGGGAGCGGCTTCTCAGGGCCCGCGGGGAGGCAGACCGGACCCTGGAG
GTCATGCGCCAACAGCTGACAGAGCTGTACCGTGACATTTTCCAGCACCTTCGGGATGAA
TCAGGCAACAGCTACTCTCCTGAAGAGTACGCGCTGCAACAGGCTGCCGATGGGACCATC
TTCCTTGTGCCCCGGGGGACCAAGATGGAGGCCACAGACTGA
Protein Properties
Number of Residues 373
Molecular Weight 41472.2
Theoretical pI 4.59
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Transcription factor NF-E2 45 kDa subunit
MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPP
PPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPL
QDPLALLDIGLPAGPPKPQEDPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEY
PYSLMPNSLAHSNYTLPAAETPLALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPTD
KIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAAQNCRKRKLETIVQLERELER
LTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSPEEYALQQAADGTI
FLVPRGTKMEATD
GenBank ID Protein 13477165
UniProtKB/Swiss-Prot ID Q16621
UniProtKB/Swiss-Prot Entry Name NFE2_HUMAN
PDB IDs Not Available
GenBank Gene ID BC005044
GeneCard ID NFE2
GenAtlas ID NFE2
HGNC ID HGNC:7780
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hung HL, Kim AY, Hong W, Rakowski C, Blobel GA: Stimulation of NF-E2 DNA binding by CREB-binding protein (CBP)-mediated acetylation. J Biol Chem. 2001 Apr 6;276(14):10715-21. Epub 2001 Jan 11. [PubMed:11154691 ]
  3. Chan JY, Han XL, Kan YW: Isolation of cDNA encoding the human NF-E2 protein. Proc Natl Acad Sci U S A. 1993 Dec 1;90(23):11366-70. [PubMed:8248255 ]
  4. Ney PA, Andrews NC, Jane SM, Safer B, Purucker ME, Weremowicz S, Morton CC, Goff SC, Orkin SH, Nienhuis AW: Purification of the human NF-E2 complex: cDNA cloning of the hematopoietic cell-specific subunit and evidence for an associated partner. Mol Cell Biol. 1993 Sep;13(9):5604-12. [PubMed:8355703 ]
  5. Pischedda C, Cocco S, Melis A, Marini MG, Kan YW, Cao A, Moi P: Isolation of a differentially regulated splicing isoform of human NF-E2. Proc Natl Acad Sci U S A. 1995 Apr 11;92(8):3511-5. [PubMed:7724591 ]
  6. Shyu YC, Lee TL, Ting CY, Wen SC, Hsieh LJ, Li YC, Hwang JL, Lin CC, Shen CK: Sumoylation of p45/NF-E2: nuclear positioning and transcriptional activation of the mammalian beta-like globin gene locus. Mol Cell Biol. 2005 Dec;25(23):10365-78. [PubMed:16287851 ]
  7. Lee TL, Shyu YC, Hsu TY, Shen CK: Itch regulates p45/NF-E2 in vivo by Lys63-linked ubiquitination. Biochem Biophys Res Commun. 2008 Oct 24;375(3):326-30. doi: 10.1016/j.bbrc.2008.07.164. Epub 2008 Aug 19. [PubMed:18718448 ]