You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02536
Secondary Accession Numbers
  • 8034
Name Histone acetyltransferase KAT2A
Synonyms
  1. General control of amino acid synthesis protein 5-like 2
  2. Histone acetyltransferase GCN5
  3. HsGCN5
  4. Lysine acetyltransferase 2A
  5. STAF97
Gene Name KAT2A
Protein Type Enzyme
Biological Properties
General Function Involved in N-acetyltransferase activity
Specific Function Functions as a histone acetyltransferase (HAT) to promote transcriptional activation. Acetylation of histones gives a specific tag for epigenetic transcription activation. Has significant histone acetyltransferase activity with core histones, but not with nucleosome core particles. In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
Pathways
  • HTLV-I infection
  • Notch signaling pathway
  • Viral carcinogenesis
Reactions
Acetyl-CoA + [histone] → Coenzyme A + acetyl-[histone] details
GO Classification
Biological Process
transcription from RNA polymerase II promoter
cell proliferation
in utero embryonic development
somitogenesis
regulation of protein stability
chromatin remodeling
regulation of transcription from RNA polymerase II promoter
virus-host interaction
regulation of apoptotic process
multicellular organism growth
histone deubiquitination
histone H3-K14 acetylation
metencephalon development
midbrain development
neural tube closure
telencephalon development
Cellular Component
Ada2/Gcn5/Ada3 transcription activator complex
STAGA complex
transcription factor TFTC complex
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
acetyltransferase activity
n-acetyltransferase activity
lysine n-acetyltransferase activity
histone acetyltransferase activity
Molecular Function
transcription coactivator activity
chromatin binding
H3 histone acetyltransferase activity
histone acetyltransferase activity (H4-K12 specific)
Process
metabolic process
cellular process
cellular component organization at cellular level
organelle organization
chromosome organization
chromatin organization
chromatin modification
covalent chromatin modification
histone modification
histone acetylation
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location 17
Locus 17q21
SNPs KAT2A
Gene Sequence
>2514 bp
ATGGCGGAACCTTCCCAGGCCCCGACCCCGGCCCCGGCTGCGCAGCCCCGGCCCCTTCAG
TCCCCAGCCCCTGCCCCAACTCCGACTCCTGCACCCAGCCCGGCTTCAGCCCCGATTCCG
ACTCCCACCCCGGCACCAGCCCCTGCCCCAGCTGCAGCCCCAGCCGGCAGCACAGGGACT
GGGGGGCCCGGGGTAGGAAGTGGGGGGGCCGGGAGCGGGGGGGATCCGGCTCGGCCTGGC
CTGAGCCAGCAGCAGCGCGCCAGTCAGAGGAAGGCGCAAGTCCGGGGGCTGCCCCGCGCC
AAGAAGCTTGAGAAGCTAGGGGTCTTCTCGGCTTGCAAGGCCAATGGAACCTGTAAGTGT
AATGGCTGGAAAAACCCCAAGCCCCCCACTGCACCCCGCATAGATCTGCAGCAGCCAGCT
GCCAACCTGAGTGAGCTGTGCCGCAGTTGTGAGCACCCCTTGGCTGACCACGTATCCCAC
TTGGAGAATGTGTCAGAGGATGAGATAAACCGACTGCTGGGGATGGTGGTGGATGTGGAG
AATCTCTTCATGTCTGTTCACAAGGAAGAGGACACAGACACCAAGCAGGTCTATTTCTAC
CTCTTCAAGCTACTGCGGAAATGCATCCTGCAGATGACCCGGCCTGTGGTGGAGGGGTCC
CTGGGCAGCCCTCCATTTGAGAAACCTAATATTGAGCAGGGTGTGCTGAACTTTGTGCAG
TACAAGTTTAGTCACCTGGCTCCCCGGGAGCGGCAGACGATGTTCGAGCTCTCAAAGATG
TTCTTGCTCTGCCTTAACTACTGGGAGCTTGAGACACCTGCCCAGTTTCGGCAGAGGTCT
CAGGCTGAGGACGTGGCTACCTACAAGGTCAATTACACCAGATGGCTCTGTTACTGCCAC
GTGCCCCAGAGCTGTGATAGCCTCCCCCGCTACGAAACCACTCATGTCTTTGGGCGAAGC
CTTCTCCGGTCCATTTTCACCGTTACCCGCCGGCAGCTGCTGGAAAAGTTCCGAGTGGAG
AAGGACAAATTGGTGCCCGAGAAGAGGACCCTCATCCTCACTCACTTCCCCAAATTCCTG
TCCATGCTGGAGGAGGAGATCTATGGGGCAAACTCTCCAATCTGGGAGTCAGGCTTCACC
ATGCCACCCTCAGAGGGGACACAGCTGGTTCCCCGGCCAGCTTCAGTCAGTGCAGCGGTT
GTTCCCAGCACCCCCATCTTCAGCCCCAGCATGGGTGGGGGCAGCAACAGCTCCCTGAGT
CTGGATTCTGCAGGGGCCGAGCCTATGCCAGGCGAGAAGAGGACGCTCCCAGAGAACCTG
ACCCTGGAGGATGCCAAGCGGCTCCGTGTGATGGGTGACATCCCCATGGAGCTGGTCAAT
GAGGTCATGCTGACCATCACTGACCCTGCTGCCATGCTGGGGCCTGAGACGAGCCTGCTT
TCGGCCAATGCGGCCCGGGATGAGACAGCCCGCCTGGAGGAGCGCCGCGGCATCATCGAG
TTCCATGTCATCGGCAACTCACTGACGCCCAAGGCCAACCGGCGGGTGTTGCTGTGGCTC
GTGGGGCTGCAGAATGTCTTTTCCCACCAGCTGCCGCGCATGCCTAAGGAGTATATCGCC
CGCCTCGTCTTTGACCCGAAGCACAAGACTCTGGCCTTGATCAAGGATGGGCGGGTCATC
GGTGGCATCTGCTTCCGCATGTTTCCCACCCAGGGCTTCACGGAGATTGTCTTCTGTGCT
GTCACCTCGAATGAGCAGGTCAAGGGTTATGGGACCCACCTGATGAACCACCTGAAGGAG
TATCACATCAAGCACAACATTCTCTACTTCCTCACCTACGCCGACGAGTACGCCATCGGC
TACTTCAAAAAGCAGGGTTTCTCCAAGGACATCAAGGTGCCCAAGAGCCGCTACCTGGGC
TACATCAAGGACTACGAGGGAGCGACGCTGATGGAGTGTGAGCTGAATCCCCGCATCCCC
TACACGGAGCTGTCCCACATCATCAAGAAGCAGAAAGAGATCATCAAGAAGCTGATTGAG
CGCAAACAGGCCCAGATCCGCAAGGTCTACCCGGGGCTCAGCTGCTTCAAGGAGGGCGTG
AGGCAGATCCCTGTGGAGAGCGTTCCTGGCATTCGAGAGACAGGCTGGAAGCCATTGGGG
AAGGAGAAGGGGAAGGAGCTGAAGGACCCCGACCAGCTCTACACAACCCTCAAAAACCTG
CTGGCCCAAATCAAGTCTCACCCCAGTGCCTGGCCCTTCATGGAGCCTGTGAAGAAGTCG
GAGGCCCCTGACTACTACGAGGTCATCCGCTTCCCCATTGACCTGAAGACCATGACTGAG
CGGCTGCGAAGCCGCTACTACGTGACCCGGAAGCTCTTTGTGGCCGACCTGCAGCGGGTC
ATCGCCAACTGTCGCGAGTACAACCCCCCGGACAGCGAGTACTGCCGCTGTGCCAGCGCC
CTGGAGAAGTTCTTCTACTTCAAGCTCAAGGAGGGAGGCCTCATTGACAAGTAG
Protein Properties
Number of Residues 837
Molecular Weight 93924.72
Theoretical pI 9.04
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Histone acetyltransferase KAT2A
MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGT
GGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLS
LDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLL
SANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA
RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE
YHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIP
YTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLG
KEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTE
RLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
GenBank ID Protein 3220164
UniProtKB/Swiss-Prot ID Q92830
UniProtKB/Swiss-Prot Entry Name KAT2A_HUMAN
PDB IDs
GenBank Gene ID AF029777
GeneCard ID KAT2A
GenAtlas ID KAT2A
HGNC ID HGNC:4201
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  3. Yang XJ, Ogryzko VV, Nishikawa J, Howard BH, Nakatani Y: A p300/CBP-associated factor that competes with the adenoviral oncoprotein E1A. Nature. 1996 Jul 25;382(6589):319-24. [PubMed:8684459 ]
  4. Gangisetty O, Lauffart B, Sondarva GV, Chelsea DM, Still IH: The transforming acidic coiled coil proteins interact with nuclear histone acetyltransferases. Oncogene. 2004 Apr 1;23(14):2559-63. [PubMed:14767476 ]
  5. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  6. Gangloff YG, Pointud JC, Thuault S, Carre L, Romier C, Muratoglu S, Brand M, Tora L, Couderc JL, Davidson I: The TFIID components human TAF(II)140 and Drosophila BIP2 (TAF(II)155) are novel metazoan homologues of yeast TAF(II)47 containing a histone fold and a PHD finger. Mol Cell Biol. 2001 Aug;21(15):5109-21. [PubMed:11438666 ]
  7. Candau R, Moore PA, Wang L, Barlev N, Ying CY, Rosen CA, Berger SL: Identification of human proteins functionally conserved with the yeast putative adaptors ADA2 and GCN5. Mol Cell Biol. 1996 Feb;16(2):593-602. [PubMed:8552087 ]
  8. Smith ER, Belote JM, Schiltz RL, Yang XJ, Moore PA, Berger SL, Nakatani Y, Allis CD: Cloning of Drosophila GCN5: conserved features among metazoan GCN5 family members. Nucleic Acids Res. 1998 Jun 15;26(12):2948-54. [PubMed:9611240 ]
  9. Martinez E, Palhan VB, Tjernberg A, Lymar ES, Gamper AM, Kundu TK, Chait BT, Roeder RG: Human STAGA complex is a chromatin-acetylating transcription coactivator that interacts with pre-mRNA splicing and DNA damage-binding factors in vivo. Mol Cell Biol. 2001 Oct;21(20):6782-95. [PubMed:11564863 ]
  10. Brand M, Yamamoto K, Staub A, Tora L: Identification of TATA-binding protein-free TAFII-containing complex subunits suggests a role in nucleosome acetylation and signal transduction. J Biol Chem. 1999 Jun 25;274(26):18285-9. [PubMed:10373431 ]
  11. McMahon SB, Wood MA, Cole MD: The essential cofactor TRRAP recruits the histone acetyltransferase hGCN5 to c-Myc. Mol Cell Biol. 2000 Jan;20(2):556-62. [PubMed:10611234 ]
  12. Col E, Caron C, Seigneurin-Berny D, Gracia J, Favier A, Khochbin S: The histone acetyltransferase, hGCN5, interacts with and acetylates the HIV transactivator, Tat. J Biol Chem. 2001 Jul 27;276(30):28179-84. Epub 2001 May 30. [PubMed:11384967 ]
  13. Zhao Y, Lang G, Ito S, Bonnet J, Metzger E, Sawatsubashi S, Suzuki E, Le Guezennec X, Stunnenberg HG, Krasnov A, Georgieva SG, Schule R, Takeyama K, Kato S, Tora L, Devys D: A TFTC/STAGA module mediates histone H2A and H2B deubiquitination, coactivates nuclear receptors, and counteracts heterochromatin silencing. Mol Cell. 2008 Jan 18;29(1):92-101. doi: 10.1016/j.molcel.2007.12.011. [PubMed:18206972 ]
  14. Guelman S, Kozuka K, Mao Y, Pham V, Solloway MJ, Wang J, Wu J, Lill JR, Zha J: The double-histone-acetyltransferase complex ATAC is essential for mammalian development. Mol Cell Biol. 2009 Mar;29(5):1176-88. doi: 10.1128/MCB.01599-08. Epub 2008 Dec 22. [PubMed:19103755 ]
  15. Hudson BP, Martinez-Yamout MA, Dyson HJ, Wright PE: Solution structure and acetyl-lysine binding activity of the GCN5 bromodomain. J Mol Biol. 2000 Dec 1;304(3):355-70. [PubMed:11090279 ]