You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02626
Secondary Accession Numbers
  • 8125
Name Cubilin
Synonyms
  1. 460 kDa receptor
  2. Intestinal intrinsic factor receptor
  3. Intrinsic factor-cobalamin receptor
  4. Intrinsic factor-vitamin B12 receptor
Gene Name CUBN
Protein Type Transporter
Biological Properties
General Function Involved in calcium ion binding
Specific Function Cotransporter which plays a role in lipoprotein, vitamin and iron metabolism, by facilitating their uptake. Binds to ALB, MB, Kappa and lambda-light chains, TF, hemoglobin, GC, SCGB1A1, APOA1, high density lipoprotein, and the GIF-cobalamin complex. The binding of all ligands required calcium. Serves as important transporter in several absorptive epithelia, including intestine, renal proximal tubules and embryonic yolk sac. Interaction with LRP2 mediates its trafficking throughout vesicles and facilitates the uptake of specific ligands like GC, hemoglobin, ALB, TF and SCGB1A1. Interaction with AMN controls its trafficking to the plasma membrane and facilitates endocytosis of ligands. May play an important role in the development of the peri-implantation embryo through internalization of APOA1 and cholesterol. Binds to LGALS3 at the maternal-fetal interface
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location
  1. Peripheral membrane protein
  2. Peripheral membrane protein
  3. Endosome membrane
  4. Lysosome membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 10p12.31
SNPs CUBN
Gene Sequence
>10872 bp
ATGATGAACATGTCTTTACCTTTTCTTTGGAGTTTGCTTACCTTATTAATATTTGCTGAA
GTAAATGGCGAACGTGGAGAACTTGAGCTGCAGAGACAAAAAAGAAGCATCAATCTCCAA
CAGCCTCGAATGGCTACAGAGAGAGGAAATTTGGTGTTTCTTACGGGGTCTGCTCAAAAC
ATTGAGTTTAGAACCGGATCCCTGGGAAAAATTAAATTAAATGATGAAGATCTCAGTGAG
TGTTTACATCAGATCCAGAAAAACAAAGAAGATATTATAGAGTTAAAAGGGAGCGCAATT
GGTCTGCCTCAAAATATATCTAGTCAAATCTATCAGCTTAATTCCAAGCTGGTGGATCTT
GAGAGAAAATTCCAAGGCTTGCAGCAGACTGTTGACAAAAAGGTTTGCAGCAGCAATCCT
TGCCAGAATGGTGGGAACTGCCTCAATCTGCATGATTCCTTTTTTTGTATCTGTCCCCCA
CAGTGGAAGGGTCCTCTCTGCTCAGCTGATGTTAACGAATGTGAGATTTACTCAGGAACA
CCCTTGAGCTGCCAGAATGGAGGCACATGTGTTAATACAATGGGAAGTTACAGTTGTCAC
TGCCCACCTGAGACGTACGGACCCCAGTGTGCATCCAAATATGACGACTGTGAAGGGGGT
TCTGTGGCACGCTGTGTCCATGGCATCTGTGAGGATTTAATGCGAGAGCAAGCTGGAGAG
CCCAAGTACAGCTGCGTCTGTGATGCTGGGTGGATGTCTTCACCCAACAGCCCTGCCTGC
ACGCTGGACAGAGACGAGTGCAGCTTCCAGCCCGGGCCTTGCTCCACACTTGTGCAGTGT
TTCAACACTCAAGGCTCTTTCTACTGTGGGGCCTGTCCAACAGGCTGGCAAGGCAATGGA
TATATTTGCGAAGATATCAATGAATGTGAGATAAATAATGGCGGCTGTTCTGTGGCTCCA
CCCGTTGAGTGTGTGAATACACCTGGGTCTTCCCACTGCCAGGCCTGTCCACCAGGGTAC
CAGGGTGACGGAAGAGTGTGCACACTCACAGACATCTGCTCAGTCAGTAATGGAGGCTGC
CACCCAGATGCCTCATGCTCCTCAACTCTAGGTTCCTTACCTCTCTGCACGTGTCTCCCG
GGTTATACTGGAAATGGTTATGGGCCAAATGGATGTGTGCAGCTCAGTAATATTTGCCTA
AGTCACCCCTGTCTAAATGGACAATGCATCGACACTGTCTCTGGTTATTTTTGTAAGTGT
GACTCAGGTTGGACAGGTGTCAACTGTACAGAAAACATCAATGAGTGTTTGAGCAACCCC
TGTTTGAATGGAGGAACTTGTGTTGATGGCGTTGATTCTTTCAGTTGTGAATGCACACGT
CTCTGGACTGGAGCTCTCTGTCAGGTTCCTCAGCAAGTTTGTGGAGAGTCCCTCTCAGGA
ATAAATGGAAGCTTCAGCTACAGGAGCCCGGATGTTGGTTATGTTCATGATGTTAACTGC
TTCTGGGTTATCAAAACTGAAATGGGAAAGGTCCTGCGTATCACTTTCACTTTTTTCCGG
TTAGAATCCATGGACAACTGTCCACACGAGTTTCTTCAGGTTTATGATGGAGATTCCTCT
TCTGCTTTTCAACTTGGAAGATTTTGTGGCTCCAGCCTCCCTCATGAACTCCTCAGCAGT
GACAATGCTCTCTATTTTCATCTCTATTCTGAACATTTAAGAAATGGGAGAGGCTTTACA
GTAAGATGGGAAACACAGCAACCAGAGTGTGGAGGTATCCTGACTGGTCCTTACGGTTCT
ATTAAGTCTCCGGGGTATCCTGGAAACTATCCCCCAGGAAGAGATTGTGTCTGGATTGTT
GTAACTAGTCCTGACCTCCTGGTAACATTTACTTTTGGGACCTTGAGCCTCGAGCACCAT
GATGACTGCAACAAAGATTACCTTGAGATTCGAGATGGTCCTTTGTATCAGGACCCCCTT
CTTGGGAAGTTCTGCACCACTTTCTCTGTCCCACCGCTCCAGACTACTGGCCCCTTTGCC
AGAATTCACTTCCATTCAGACTCCCAGATTAGTGACCAAGGCTTCCATATCACCTACTTA
ACATCACCTTCGGATCTGCGTTGTGGTGGGAACTACACGGACCCAGAGGGTGAACTCTTC
TTGCCTGAGTTGTCTGGGCCTTTCACTCACACCAGGCAATGCGTCTATATGATGAAGCAG
CCCCAGGGAGAACAAATACAAATCAACTTCACCCACGTGGAGCTGCAATGCCAGAGTGAC
AGTTCTCAGAATTACATTGAGGTTCGAGATGGTGAAACCTTACTTGGAAAAGTCTGTGGC
AACGGAACCATCTCTCACATTAAATCCATTACTAATAGTGTCTGGATCAGGTTTAAAATA
GATGCTTCTGTTGAAAAAGCTAGTTTCAGAGCTGTTTATCAAGTCGCTTGCGGGGATGAA
TTAACTGGAGAAGGGGTCATTCGCTCGCCTTTTTTTCCTAACGTGTATCCTGGAGAAAGA
ACCTGTAGGTGGACCATCCACCAGCCCCAAAGCCAAGTCATTCTCCTCAACTTCACTGTC
TTTGAAATTGGAAGTTCTGCCCACTGTGAAACAGATTATGTTGAGATTGGTAGCAGTTCC
ATTTTGGGTTCTCCTGAAAATAAAAAGTATTGCGGTACAGACATACCTTCATTTATAACA
TCTGTGTACAATTTTCTTTATGTCACATTCGTGAAAAGTTCTTCTACTGAAAACCATGGT
TTCATGGCTAAGTTCAGTGCTGAGGATTTGGCATGTGGAGAAATTCTTACAGAATCAACA
GGGACCATTCAAAGTCCTGGCCATCCAAATGTCTACCCCCACGGTATCAACTGTACTTGG
CATATATTAGTCCAACCTAATCACCTGATTCATTTAATGTTCGAAACATTTCATCTGGAG
TTTCATTACAATTGCACAAACGACTACTTGGAAGTTTATGACACCGACTCTGAGACATCC
CTTGGAAGATACTGTGGAAAGTCGATCCCGCCATCTCTCACAAGCAGTGGTAACTCATTG
ATGCTGGTGTTTGTGACTGACTCCGACCTCGCTTATGAAGGCTTCTTAATAAACTATGAA
GCAATCAGTGCAGCAACAGCATGTTTGCAAGACTACACAGATGATTTGGGGACATTCACT
TCTCCAAACTTCCCCAATAATTATCCCAACAACTGGGAATGCATTTATCGGATCACAGTG
AGAACTGGCCAACTGATTGCAGTGCACTTCACAAACTTCTCCTTGGAGGAAGCCATTGGA
AACTATTATACAGATTTTCTGGAAATCAGAGATGGAGGCTATGAAAAATCACCATTGCTG
GGAATATTCTATGGCTCAAATCTACCCCCAACAATCATCTCTCATAGTAACAAACTATGG
TTAAAATTTAAGAGTGACCAAATAGACACAAGGTCTGGATTCTCAGCTTACTGGGATGGG
TCATCAACAGGTTGCGGGGGTAATCTCACCACTTCAAGCGGTACGTTCATATCTCCCAAC
TACCCGATGCCCTATTACCACAGCTCTGAATGCTACTGGTGGTTGAAATCTAGCCACGGC
AGCGCATTTGAACTGGAATTCAAAGACTTTCACTTGGAGCATCATCCAAACTGCACTTTA
GATTACCTGGCTGTATATGATGGCCCAAGTAGCAACTCTCATCTGCTAACTCAGCTTTGT
GGGGATGAGAAACCCCCTCTTATTCGTTCTAGTGGAGACAGCATGTTTATAAAACTGAGG
ACAGATGAAGGTCAGCAAGGACGTGGCTTCAAGGCTGAATACCGGCAGACATGTGAGAAT
GTGGTAATAGTCAATCAAACCTATGGCATCTTAGAGAGTATAGGGTATCCGAATCCTTAT
TCTGAAAATCAGCATTGCAACTGGACCATCCGGGCAACAACAGGCAACACTGTGAACTAC
ACATTTTTAGCATTTGACTTGGAACATCACATAAACTGCTCCACAGATTATTTAGAGCTC
TATGATGGACCACGGCAGATGGGACGCTACTGTGGAGTAGACCTGCCCCCTCCAGGGAGT
ACTACAAGCTCCAAGCTTCAAGTGCTGCTCCTTACAGATGGGGTTGGCCGCCGTGAGAAA
GGATTTCAGATGCAGTGGTTTGTTTACGGTTGTGGTGGAGAGCTGTCTGGGGCCACAGGC
TCCTTCAGCAGCCCCGGGTTCCCCAACAGGTATCCACCAAACAAGGAGTGTATCTGGTAC
ATTAGGACGGACCCCGGGAGTAGCATTCAGCTCACCATCCATGACTTCGATGTGGAGTAT
CATTCAAGGTGCAACTTTGATGTCTTGGAGATCTATGGAGGCCCCGATTTCCACTCTCCC
AGAATAGCCCAACTGTGTACCCAGAGATCACCTGAGAACCCCATGCAGGTCTCCAGCACT
GGAAATGAGCTAGCAATTCGATTCAAGACCGACTTGTCCATAAATGGGAGAGGCTTCAAT
GCGTCATGGCAAGCAGTCACTGGAGGTTGTGGTGGGATTTTCCAGGCTCCCAGTGGAGAG
ATTCATTCTCCAAATTACCCCAGTCCTTATAGGAGCAACACAGACTGTTCTTGGGTCATT
CGGGTTGACAGATATCATCGTGTTCTCTTGAACTTCACTGACTTTGATCTTGAACCACAA
GACTCTTGTATTATGGCATACGATGGCTTAAGCTCCACAATGTCCCGCCTTGCCAGGACG
TGTGGAAGGGAGCAGCTGGCTAACCCCATCGTCTCCTCAGGAAACAGCCTCTTCTTGAGA
TTTCAGTCTGGCCCTTCCAGACAGAACAGAGGCTTCCGAGCTCAATTCAGGCAAGCCTGC
GGAGGCCACATCCTCACCAGCTCATTTGATACTGTTTCCTCTCCACGGTTCCCTGCCAAT
TATCCAAACAATCAGAACTGCAGCTGGATCATTCAAGCGCAACCTCCATTAAATCATATC
ACCCTCTCTTTTACCCACTTTGAACTTGAAAGAAGCACAACGTGTGCACGTGACTTTGTA
GAAATTTTGGATGGCGGCCACGAAGACGCGCCCCTCCGAGGCCGTTACTGTGGCACCGAC
ATGCCCCATCCTATCACATCCTTCAGCAGCGCCCTGACGCTGAGATTCGTCTCTGATTCT
AGCATCAGTGCTGGGGGTTTCCACACCACGGTCACCGCATCAGTGTCGGCTTGTGGTGGA
ACGTTCTACATGGCTGAAGGCATCTTCAACAGCCCTGGCTACCCAGACATTTATCCCCCT
AATGTGGAATGTGTCTGGAACATCATCAGTTCCCCTGGCAACCGGCTCCAGCTGTCTTTT
ATATCTTTCCAGTTGGAAGACTCTCAGGACTGCAGCAGAGATTTTGTGGAGATCCGTGAA
GGAAATGCCACGGGTCACTTGGTGGGACGATACTGTGGAAACTCCTTCCCTCTCAATTAT
TCTTCCATCGTTGGACATACCCTGTGGGTCAGATTTATCTCAGATGGTTCTGGCAGCGGC
ACGGGCTTCCAGGCCACATTTATGAAGATATTTGGCAATGATAATATTGTGGGAACTCAT
GGGAAAGTCGCCTCTCCTTTCTGGCCTGAAAACTACCCACATAACTCCAATTACCAATGG
ACAGTAAATGTGAATGCATCTCACGTTGTCCATGGTAGAATCTTGGAGATGGACATAGAA
GAAATACAAAACTGCTATTATGACAAATTAAGGATCTATGATGGGCCTAGCATTCACGCC
CGCCTAATTGGAGCTTACTGTGGTACCCAGACTGAATCTTTCAGCTCCACTGGAAATTCT
TTGACATTTCATTTTTACTCCGACTCTTCAATCTCGGGGAAGGGATTCCTTCTGGAGTGG
TTTGCAGTGGATGCACCTGATGGTGTTTTACCTACCATTGCTCCAGGTGCTTGTGGTGGC
TTCCTGAGGACGGGAGATGCACCCGTGTTTCTCTTCTCCCCGGGCTGGCCTGACAGTTAC
AGTAATAGAGTGGACTGTACGTGGCTCATCCAGGCTCCCGACTCTACCGTGGAACTCAAC
ATTCTTTCCCTGGACATTGAATCTCACCGAACGTGTGCCTATGATAGCCTTGTGATACGA
GATGGAGATAATAACTTGGCCCAGCAGCTAGCAGTTCTCTGTGGCAGAGAGATCCCTGGG
CCCATCCGGTCTACTGGAGAGTACATGTTCATCCGCTTCACCTCGGACTCCAGTGTAACC
AGGGCAGGCTTCAATGCATCCTTTCACAAGAGCTGCGGTGGATATTTGCATGCAGACAGA
GGGATCATCACGTCCCCCAAGTATCCAGAGACTTACCCATCCAACCTCAACTGTTCTTGG
CACGTCCTGGTCCAAAGTGGCCTGACCATTGCTGTCCATTTTGAACAGCCTTTCCAGATT
CCAAATGGAGATTCTTCTTGCAACCAGGGGGATTACTTGGTGCTAAGAAATGGTCCTGAT
ATCTATTCTCCACCCTTGGGACCCCCTGGAGGAAATGGTCATTTTTGTGGCAGTCATGCT
TCATCAACTCTGTTCACCTCGGATAATCAAATGTTTGTTCAGTTTATTTCTGATCACAGT
AATGAAGGGCAAGGATTTAAAATCAAATATGAGGCAAAGAGTTTAGCCTGTGGGGGCAAC
GTCTACATCCATGATGCTGATTCTGCTGGGTATGTGACCTCCCCCAACCACCCTCATAAT
TATCCCCCGCACGCTGATTGCATTTGGATCTTAGCGGCTCCACCGGAAACACGCATACAG
CTGCAATTTGAAGATCGATTCGATATTGAAGTAACACCCAACTGTACTTCCAACTACCTT
GAGTTGCGGGATGGAGTGGATTCGGATGCACCAATACTTTCCAAATTTTGTGGGACATCT
TTGCCCAGCAGTCAGTGGTCCTCAGGAGAGGTTATGTATTTGAGATTTCGATCTGACAAC
AGCCCCACACATGTGGGATTCAAGGCCAAGTATTCTATAGCTCAGTGTGGGGGAAGAGTA
CCAGGGCAAAGTGGTGTTGTTGAAAGCATTGGACATCCAACACTTCCATACAGAGACAAC
TTATTCTGTGAGTGGCATCTCCAGGGGCTCTCTGGACACTATCTCACCATCTCTTTTGAA
GACTTTAACCTTCAGAATTCTTCTGGCTGTGAAAAAGACTTCGTGGAGATCTGGGACAAT
CATACCTCTGGAAACATCTTGGGCAGATACTGTGGAAACACCATTCCTGACAGCATAGAC
ACTTCTAGCAATACTGCTGTGGTCAGGTTTGTCACAGACGGCTCTGTGACTGCCTCAGGA
TTCAGACTGCGATTTGAATCCAGTATGGAAGAGTGTGGTGGGGATCTTCAGGGCTCTATT
GGAACATTTACTTCTCCCAACTACCCGAACCCAAATCCTCATGGCCGGATCTGCGAGTGG
AGAATCACTGCCCCGGAGGGAAGGCGGATCACCCTAATGTTTAACAACCTGAGGCTGGCC
ACGCATCCGTCCTGCAACAATGAGCATGTGATAGTATTCAATGGCATTAGAAGTAACTCA
CCCCAGCTAGAGAAACTGTGTAGTAGTGTGAATGTAAGCAATGAGATTAAATCTTCAGGA
AACACAATGAAAGTCATTTTTTTCACGGATGGATCCAGGCCATATGGCGGCTTCACTGCT
TCCTATACCTCCAGTGAAGATGCAGTGTGTGGTGGGTCTCTTCCAAATACTCCTGAAGGA
AACTTTACTTCTCCTGGCTATGACGGAGTCAGGAATTACTCAAGAAACCTGAACTGCGAA
TGGACTCTCAGCAATCCAAATCAGGGAAATTCATCCATTTCCATTCACTTTGAAGATTTT
TACCTAGAAAGTCACCAAGACTGTCAATTTGATGTCCTCGAGTTTCGAGTGGGTGATGCT
GATGGGCCCCTGATGTGGAGACTTTGTGGTCCTTCAAAGCCTACATTGCCATTGGTTATA
CCTTATTCTCAGGTATGGATTCACTTTGTCACCAACGAACGTGTAGAACACATTGGATTC
CATGCAAAGTATTCCTTTACAGATTGTGGCGGAATACAGATAGGTGACAGTGGAGTGATC
ACAAGCCCCAACTATCCAAATGCTTATGACAGCCTGACCCACTGCTCTTGGCTGTTGGAG
GCCCCACAAGGGCACACCATCACTCTCACATTTAGTGACTTTGATATTGAACCCCATACA
ACTTGTGCTTGGGACTCTGTCACTGTCAGGAATGGTGGGTCCCCTGAATCACCCATCATA
GGACAATACTGTGGAAATTCAAACCCCAGGACAATACAGTCAGGTTCCAATCAGCTGGTC
GTGACTTTTAACTCAGACCATTCATTGCAAGGTGGTGGATTTTATGCTACGTGGAACACA
CAAACTTTAGGTTGTGGTGGAATATTTCATTCTGATAATGGTACAATCAGATCCCCTCAC
TGGCCTCAGAATTTTCCCGAAAACAGCAGATGTTCCTGGACGGCCATTACTCACAAAAGT
AAACACTTGGAGATCAGCTTTGACAACAACTTCCTAATCCCCAGCGGTGATGGACAATGT
CAGAATAGCTTCGTGAAGGTGTGGGCAGGAACTGAGGAGGTGGACAAAGCCCTGCTAGCC
ACTGGCTGTGGGAACGTGGCTCCGGGTCCCGTTATCACACCAAGTAACACATTCACTGCC
GTCTTCCAGTCTCAGGAGGCACCAGCTCAGGGCTTCTCCGCGTCCTTTGTTAGCCGATGT
GGAAGTAATTTCACTGGCCCTTCAGGTTACATCATTTCTCCAAATTACCCAAAACAATAT
GACAACAACATGAATTGCACCTATGTCATAGAGGCTAATCCTCTGTCAGTGGTCCTCTTG
ACTTTTGTGTCCTTCCACTTAGAAGCTCGTTCCGCTGTGACGGGAAGCTGTGTCAACGAT
GGCGTGCACATTATCAGAGGTTACAGCGTCATGTCCACCCCATTTGCTACTGTGTGTGGG
GATGAGATGCCAGCTCCCCTCACCATCGCTGGGCCGGTTCTGCTTAACTTCTACTCCAAC
GAGCAAATCACAGACTTCGGATTCAAGTTTTCCTATAGGATAATCTCCTGTGGTGGTGTG
TTCAATTTCTCTTCTGGAATCATCACAAGTCCTGCCTATTCATACGCAGACTACCCAAAT
GATATGCACTGTCTGTATACCATCACCGTTAGTGACGACAAGGTGATCGAGCTCAAGTTC
AGTGATTTTGATGTGGTTCCCTCCACCTCCTGCTCCCATGACTACCTGGCAATTTACGAT
GGTGCCAATACCAGCGATCCCCTTCTTGGCAAATTCTGCGGTTCCAAGCGCCCACCAAAT
GTGAAGAGCAGCAATAATAGTATGCTCCTGGTGTTCAAGACAGATTCATTTCAGACAGCA
AAAGGCTGGAAGATGTCTTTCCGGCAGACATTGGGGCCTCAGCAAGGATGTGGTGGTTAT
CTGACAGGCTCGAATAATACCTTTGCCTCTCCTGATTCTGATTCGAATGGAATGTATGAC
AAGAATTTAAACTGTGTATGGATCATAATTGCACCTGTAAACAAAGTAATTCACCTCACC
TTCAATACATTTGCTCTGGAGGCAGCAAGTACTAGGCAAAGATGCCTTTATGATTATGTA
AAGTTATATGATGGGGATAGTGAAAATGCGAACTTGGCTGGAACGTTTTGTGGTTCCACA
GTACCTGCTCCTTTTATCTCTTCTGGTAACTTCCTTACGGTTCAATTCATCAGTGACTTA
ACATTAGAGAGGGAAGGATTTAATGCTACATACACCATCATGGACATGCCTTGTGGTGGA
ACGTACAATGCAACTTGGACCCCACAAAATATTTCATCACCCAATTCATCAGACCCAGAT
GTCCCATTTTCCATCTGTACTTGGGTCATTGATTCCCCTCCGCATCAGCAGGTCAAGATA
ACTGTGTGGGCATTACAGCTGACCTCGCAAGACTGCACGCAGAATTACTTACAGCTTCAG
GACTCACCGCAGGGTCACGGAAATTCAAGATTTCAGTTCTGTGGCAGAAATGCTTCGGCT
GTGCCAGTGTTTTATTCTTCTATGAGTACTGCAATGGTCATTTTCAAATCTGGAGTTGTA
AACAGAAACTCTAGAATGAGTTTCACCTATCAGATTGCAGATTGCAACAGAGACTATCAC
AAGGCATTTGGCAACCTGAGAAGCCCTGGATGGCCAGATAACTACGACAATGACAAGGAT
TGCACCGTTACTCTCACAGCCCCCCAGAACCACACCATTTCCCTCTTTTTTCATTCACTT
GGCATCGAGAACTCAGTTGAATGCAGAAACGATTTCTTGGAGGTGAGAAATGGAAGTAAC
AGCAATTCACCATTACTGGGCAAGTACTGTGGAACTCTGCTGCCAAACCCTGTCTTCTCT
CAAAATAATGAACTATACCTACGATTTAAGAGTGATAGTGTAACTTCTGATCGTGGATAT
GAAATCATCTGGACTTCATCACCCTCTGGATGTGGTGGAACTCTTTATGGAGACAGAGGC
TCATTCACCAGCCCCGGCTATCCAGGCACATACCCAAACAACACGTACTGCGAGTGGGTC
CTTGTTGCTCCTGCTGGAAGGCTTGTCACCATCAACTTCTACTTCATCAGCATTGACGAT
CCAGGAGACTGTGTCCAGAACTATCTCACACTCTATGATGGGCCCAACGCCAGCTCTCCA
TCCTCTGGACCATACTGCGGAGGCGACACCAGCATAGCTCCCTTCGTGGCTTCCTCAAAT
CAGGTCTTCATAAAATTTCATGCTGATTATGCACGGCGTCCATCCGCATTCCGATTAACT
TGGGACAGCTAA
Protein Properties
Number of Residues 3623
Molecular Weight 398672.8
Theoretical pI 5.0
Pfam Domain Function
Signals
  • 1-23
Transmembrane Regions
  • None
Protein Sequence
>Cubilin
MMNMSLPFLWSLLTLLIFAEVNGEAGELELQRQKRSINLQQPRMATERGNLVFLTGSAQN
IEFRTGSLGKIKLNDEDLSECLHQIQKNKEDIIELKGSAIGLPQNISSQIYQLNSKLVDL
ERKFQGLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPPQWKGPLCSADVNECEIYSGT
PLSCQNGGTCVNTMGSYSCHCPPETYGPQCASKYDDCEGGSVARCVHGICEDLMREQAGE
PKYSCVCDAGWMSSPNSPACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGACPTGWQGNG
YICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLTDICSVSNGGC
HPDASCSSTLGSLPLCTCLPGYTGNGYGPNGCVQLSNICLSHPCLNGQCIDTVSGYFCKC
DSGWTGVNCTENINECLSNPCLNGGTCVDGVDSFSCECTRLWTGALCQVPQQVCGESLSG
INGSFSYRSPDVGYVHDVNCFWVIKTEMGKVLRITFTFFRLESMDNCPHEFLQVYDGDSS
SAFQLGRFCGSSLPHELLSSDNALYFHLYSEHLRNGRGFTVRWETQQPECGGILTGPYGS
IKSPGYPGNYPPGRDCVWIVVTSPDLLVTFTFGTLSLEHHDDCNKDYLEIRDGPLYQDPL
LGKFCTTFSVPPLQTTGPFARIHFHSDSQISDQGFHITYLTSPSDLRCGGNYTDPEGELF
LPELSGPFTHTRQCVYMMKQPQGEQIQINFTHVELQCQSDSSQNYIEVRDGETLLGKVCG
NGTISHIKSITNSVWIRFKIDASVEKASFRAVYQVACGDELTGEGVIRSPFFPNVYPGER
TCRWTIHQPQSQVILLNFTVFEIGSSAHCETDYVEIGSSSILGSPENKKYCGTDIPSFIT
SVYNFLYVTFVKSSSTENHGFMAKFSAEDLACGEILTESTGTIQSPGHPNVYPHGINCTW
HILVQPNHLIHLMFETFHLEFHYNCTNDYLEVYDTDSETSLGRYCGKSIPPSLTSSGNSL
MLVFVTDSDLAYEGFLINYEAISAATACLQDYTDDLGTFTSPNFPNNYPNNWECIYRITV
RTGQLIAVHFTNFSLEEAIGNYYTDFLEIRDGGYEKSPLLGIFYGSNLPPTIISHSNKLW
LKFKSDQIDTRSGFSAYWDGSSTGCGGNLTTSSGTFISPNYPMPYYHSSECYWWLKSSHG
SAFELEFKDFHLEHHPNCTLDYLAVYDGPSSNSHLLTQLCGDEKPPLIRSSGDSMFIKLR
TDEGQQGRGFKAEYRQTCENVVIVNQTYGILESIGYPNPYSENQHCNWTIRATTGNTVNY
TFLAFDLEHHINCSTDYLELYDGPRQMGRYCGVDLPPPGSTTSSKLQVLLLTDGVGRREK
GFQMQWFVYGCGGELSGATGSFSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDVEY
HSRCNFDVLEIYGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFN
ASWQAVTGGCGGIFQAPSGEIHSPNYPSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLEPQ
DSCIMAYDGLSSTMSRLARTCGREQLANPIVSSGNSLFLRFQSGPSRQNRGFRAQFRQAC
GGHILTSSFDTVSSPRFPANYPNNQNCSWIIQAQPPLNHITLSFTHFELERSTTCARDFV
EILDGGHEDAPLRGRYCGTDMPHPITSFSSALTLRFVSDSSISAGGFHTTVTASVSACGG
TFYMAEGIFNSPGYPDIYPPNVECVWNIVSSPGNRLQLSFISFQLEDSQDCSRDFVEIRE
GNATGHLVGRYCGNSFPLNYSSIVGHTLWVRFISDGSGSGTGFQATFMKIFGNDNIVGTH
GKVASPFWPENYPHNSNYQWTVNVNASHVVHGRILEMDIEEIQNCYYDKLRIYDGPSIHA
RLIGAYCGTQTESFSSTGNSLTFHFYSDSSISGKGFLLEWFAVDAPDGVLPTIAPGACGG
FLRTGDAPVFLFSPGWPDSYSNRVDCTWLIQAPDSTVELNILSLDIESHRTCAYDSLVIR
DGDNNLAQQLAVLCGREIPGPIRSTGEYMFIRFTSDSSVTRAGFNASFHKSCGGYLHADR
GIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPD
ICSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGN
VYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYL
ELRDGVDSDAPILSKFCGTSLPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYSIAQCGGRV
PGQSGVVESIGHPTLPYRDNLFCEWHLQGLSGHYLTISFEDFNLQNSSGCEKDFVEIWDN
HTSGNILGRYCGNTIPDSIDTSSNTAVVRFVTDGSVTASGFRLRFESSMEECGGDLQGSI
GTFTSPNYPNPNPHGRICEWRITAPEGRRITLMFNNLRLATHPSCNNEHVIVFNGIRSNS
PQLEKLCSSVNVSNEIKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGSLPNTPEG
NFTSPGYDGVRNYSRNLNCEWTLSNPNQGNSSISIHFEDFYLESHQDCQFDVLEFRVGDA
DGPLMWRLCGPSKPTLPLVIPYSQVWIHFVTNERVEHIGFHAKYSFTDCGGIQIGDSGVI
TSPNYPNAYDSLTHCSSLLEAPQGHTITLTFSDFDIEPHTTCAWDSVTVRNGGSPESPII
GQYCGNSNPRTIQSGSNQLVVTFNSDHSLQGGGFYATWNTQTLGCGGIFHSDNGTIRSPH
WPQNFPENSRCSWTAITHKSKHLEISFDNNFLIPSGDGQCQNSFVKVWAGTEEVDKALLA
TGCGNVAPGPVITPSNTFTAVFQSQEAPAQGFSASFVSRCGSNFTGPSGYIISPNYPKQY
DNNMNCTYVIEANPLSVVLLTFVSFHLEARSAVTGSCVNDGVHIIRGYSVMSTPFATVCG
DEMPAPLTIAGPVLLNFYSNEQITDFGFKFSYRIISCGGVFNFSSGIITSPAYSYADYPN
DMHCLYTITVSDDKVIELKFSDFDVVPSTSCSHDYLAIYDGANTSDPLLGKFCGSKRPPN
VKSSNNSMLLVFKTDSFQTAKGWKMSFRQTLGPQQGCGGYLTGSNNTFASPDSDSNGMYD
KNLNCVWIIIAPVNKVIHLTFNTFALEAASTRQRCLYDYVKLYDGDSENANLAGTFCGST
VPAPFISSGNFLTVQFISDLTLEREGFNATYTIMDMPCGGTYNATWTPQNISSPNSSDPD
VPFSICTWVIDSPPHQQVKITVWALQLTSQDCTQNYLQLQDSPQGHGNSRFQFCGRNASA
VPVFYSSMSTAMVIFKSGVVNRNSRMSFTYQIADCNRDYHKAFGNLRSPGWPDNYDNDKD
CTVTLTAPQNHTISLFFHSLGIENSVECRNDFLEVRNGSNSNSPLLGKYCGTLLPNPVFS
QNNELYLRFKSDSVTSDRGYEIIWTSSPSGCGGTLYGDRGSFTSPGYPGTYPNNTYCEWV
LVAPAGRLVTINFYFISIDDPGDCVQNYLTLYDGPNASSPSSGPYCGGDTSIAPFVASSN
QVFIKFHADYARRPSAFRLTWDS
GenBank ID Protein 3929529
UniProtKB/Swiss-Prot ID O60494
UniProtKB/Swiss-Prot Entry Name CUBN_HUMAN
PDB IDs Not Available
GenBank Gene ID AF034611
GeneCard ID CUBN
GenAtlas ID CUBN
HGNC ID HGNC:2548
References
General References
  1. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Kozyraki R, Kristiansen M, Silahtaroglu A, Hansen C, Jacobsen C, Tommerup N, Verroust PJ, Moestrup SK: The human intrinsic factor-vitamin B12 receptor, cubilin: molecular characterization and chromosomal mapping of the gene to 10p within the autosomal recessive megaloblastic anemia (MGA1) region. Blood. 1998 May 15;91(10):3593-600. [PubMed:9572993 ]
  4. Kozyraki R, Fyfe J, Kristiansen M, Gerdes C, Jacobsen C, Cui S, Christensen EI, Aminoff M, de la Chapelle A, Krahe R, Verroust PJ, Moestrup SK: The intrinsic factor-vitamin B12 receptor, cubilin, is a high-affinity apolipoprotein A-I receptor facilitating endocytosis of high-density lipoprotein. Nat Med. 1999 Jun;5(6):656-61. [PubMed:10371504 ]
  5. Nykjaer A, Fyfe JC, Kozyraki R, Leheste JR, Jacobsen C, Nielsen MS, Verroust PJ, Aminoff M, de la Chapelle A, Moestrup SK, Ray R, Gliemann J, Willnow TE, Christensen EI: Cubilin dysfunction causes abnormal metabolism of the steroid hormone 25(OH) vitamin D(3). Proc Natl Acad Sci U S A. 2001 Nov 20;98(24):13895-900. [PubMed:11717447 ]
  6. Kozyraki R, Fyfe J, Verroust PJ, Jacobsen C, Dautry-Varsat A, Gburek J, Willnow TE, Christensen EI, Moestrup SK: Megalin-dependent cubilin-mediated endocytosis is a major pathway for the apical uptake of transferrin in polarized epithelia. Proc Natl Acad Sci U S A. 2001 Oct 23;98(22):12491-6. Epub 2001 Oct 16. [PubMed:11606717 ]
  7. Fyfe JC, Madsen M, Hojrup P, Christensen EI, Tanner SM, de la Chapelle A, He Q, Moestrup SK: The functional cobalamin (vitamin B12)-intrinsic factor receptor is a novel complex of cubilin and amnionless. Blood. 2004 Mar 1;103(5):1573-9. Epub 2003 Oct 23. [PubMed:14576052 ]
  8. Caratu G, Allegra D, Bimonte M, Schiattarella GG, D'Ambrosio C, Scaloni A, Napolitano M, Russo T, Zambrano N: Identification of the ligands of protein interaction domains through a functional approach. Mol Cell Proteomics. 2007 Feb;6(2):333-45. Epub 2006 Nov 23. [PubMed:17124247 ]
  9. Aminoff M, Carter JE, Chadwick RB, Johnson C, Grasbeck R, Abdelaal MA, Broch H, Jenner LB, Verroust PJ, Moestrup SK, de la Chapelle A, Krahe R: Mutations in CUBN, encoding the intrinsic factor-vitamin B12 receptor, cubilin, cause hereditary megaloblastic anaemia 1. Nat Genet. 1999 Mar;21(3):309-13. [PubMed:10080186 ]
  10. Kristiansen M, Aminoff M, Jacobsen C, de La Chapelle A, Krahe R, Verroust PJ, Moestrup SK: Cubilin P1297L mutation associated with hereditary megaloblastic anemia 1 causes impaired recognition of intrinsic factor-vitamin B(12) by cubilin. Blood. 2000 Jul 15;96(2):405-9. [PubMed:10887099 ]