You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02668
Secondary Accession Numbers
  • 8171
Name S-arrestin
Synonyms
  1. 48 kDa protein
  2. Retinal S-antigen
  3. Rod photoreceptor arrestin
  4. S-AG
Gene Name SAG
Protein Type Unknown
Biological Properties
General Function Involved in signal transduction
Specific Function Arrestin is one of the major proteins of the ros (retinal rod outer segments); it binds to photoactivated- phosphorylated rhodopsin, thereby apparently preventing the transducin-mediated activation of phosphodiesterase
Pathways Not Available
Reactions Not Available
GO Classification
Process
multicellular organismal process
system process
neurological system process
sensory perception
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 2q37.1
SNPs SAG
Gene Sequence
>1218 bp
ATGGCAGCCAGCGGGAAGACCAGCAAGTCCGAACCGAACCATGTTATCTTCAAGAAGATC
TCCCGGGACAAATCGGTGACCATCTACCTGGGGAACAGAGACTACATAGACCATGTCAGC
CAAGTCCAGCCTGTGGATGGTGTCGTGTTGGTTGATCCTGATCTTGTGAAGGGAAAGAAA
GTGTATGTCACTCTGACCTGCGCCTTCCGCTATGGCCAAGAGGACATTGACGTGATCGGC
TTGACCTTCCGCAGGGACCTGTACTTCTCCCGGGTCCAGGTGTATCCTCCTGTGGGGGCC
GCGAGCACCCCCACAAAACTGCAAGAGAGCCTGCTTAAAAAGCTGGGGAGCAACACGTAC
CCCTTTCTCCTGACGTTTCCTGACTACTTGCCCTGTTCAGTGATGTTGCAGCCAGCTCCA
CAAGATTCAGGGAAGTCCTGTGGGGTTGACTTTGAGGTCAAAGCATTCGCCACAGACAGC
ACCGATGCCGAAGAGGACAAAATCCCCAAGAAGAGCTCCGTGCGATTACTGATCCGCAAA
GTACAGCATGCCCCACTTGAGATGGGTCCCCAGCCCCGAGCTGAGGCGGCCTGGCAGTTC
TTCATGTCTGACAAGCCCCTGCACCTTGCGGTCTCTCTCAACAAAGAGATCTATTTCCAT
GGGGAGCCCATCCCTGTGACCGTGACTGTCACCAATAACACAGAGAAGACCGTGAAGAAG
ATTAAAGCATTCGTGGAACAGGTGGCCAATGTGGTTCTCTACTCGAGTGATTATTACGTC
AAGCCCGTGGCTATGGAGGAAGCGCAAGAAAAAGTGCCACCAAACAGCACTTTGACCAAG
ACGCTGACGCTGCTGCCCTTGCTGGCTAACAATCGAGAAAGGAGAGGCATTGCCCTGGAT
GGGAAAATCAAGCACGAGGACACAAACCTTGCCTCCAGCACCATCATTAAGGAGGGCATA
GACCGGACCGTCCTGGGAATCCTGGTGTCTTACCAGATCAAGGTGAAGCTCACAGTGTCA
GGCTTTCTGGGAGAGCTCACCTCCAGTGAAGTCGCCACTGAGGTCCCATTCCGCCTCATG
CACCCTCAGCCTGAGGACCCAGCTAAGGAAAGTTATCAGGATGCAAATTTAGTTTTTGAG
GAGTTTGCTCGCCATAATCTGAAAGATGCAGGAGAAGCTGAGGAGGGGAAGAGAGACAAG
AATGACGTTGATGAGTGA
Protein Properties
Number of Residues 405
Molecular Weight 45119.2
Theoretical pI 6.53
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>S-arrestin
MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKK
VYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTY
PFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRK
VQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKK
IKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALD
GKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLM
HPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE
GenBank ID Protein 62822312
UniProtKB/Swiss-Prot ID P10523
UniProtKB/Swiss-Prot Entry Name ARRS_HUMAN
PDB IDs Not Available
GenBank Gene ID AC013726
GeneCard ID SAG
GenAtlas ID SAG
HGNC ID HGNC:10521
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Yamamoto S, Sippel KC, Berson EL, Dryja TP: Defects in the rhodopsin kinase gene in the Oguchi form of stationary night blindness. Nat Genet. 1997 Feb;15(2):175-8. [PubMed:9020843 ]
  3. Yamaki K, Tsuda M, Shinohara T: The sequence of human retinal S-antigen reveals similarities with alpha-transducin. FEBS Lett. 1988 Jul 4;234(1):39-43. [PubMed:3164688 ]
  4. Sippel KC, DeStefano JD, Berson EL, Dryja TP: Evaluation of the human arrestin gene in patients with retinitis pigmentosa and stationary night blindness. Invest Ophthalmol Vis Sci. 1998 Mar;39(3):665-70. [PubMed:9501883 ]