You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02683
Secondary Accession Numbers
  • 8186
  • HMDBP05560
Name Solute carrier organic anion transporter family member 1A2
Synonyms
  1. OATP-1
  2. OATP-A
  3. Organic anion-transporting polypeptide 1
  4. Sodium-independent organic anion transporter
  5. Solute carrier family 21 member 3
Gene Name SLCO1A2
Protein Type Transporter
Biological Properties
General Function Involved in transporter activity
Specific Function Mediates the Na(+)-independent transport of organic anions such as sulfobromophthalein (BSP) and conjugated (taurocholate) and unconjugated (cholate) bile acids
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transporter activity
Process
establishment of localization
transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 12p12
SNPs SLCO1A2
Gene Sequence
>2013 bp
ATGGGAGAAACTGAGAAAAGAATTGAAACCCATAGAATAAGATGTCTTTCCAAGTTGAAG
ATGTTTCTGTTGGCAATAACATGTGCATTTGTATCCAAAACACTGTCTGGATCTTATATG
AATTCCATGCTCACACAAATAGAGAGACAATTCAACATCCCAACATCTCTAGTTGGATTC
ATTAATGGAAGCTTTGAGATTGGAAATCTTTTGTTGATTATATTTGTGAGTTATTTTGGA
ACCAAACTGCATAGACCTATAATGATTGGCATTGGATGTGTGGTTATGGGCTTAGGCTGT
TTCTTAAAATCACTACCTCATTTCCTCATGAACCAATATGAATATGAATCTACAGTTTCA
GTTTCAGGCAACTTGTCCTCAAACAGTTTCTTGTGTATGGAAAATGGAACCCAGATTTTA
AGACCAACGCAGGATCCATCAGAGTGTACAAAGGAAGTTAAATCATTAATGTGGGTGTAC
GTCCTAGTAGGCAATATTGTACGTGGAATGGGTGAAACTCCCATCCTGCCTTTGGGTATT
TCCTATATAGAAGATTTTGCCAAATTTGAAAATTCTCCTTTATATATTGGGCTTGTAGAA
ACAGGAGCTATTATTGGTCCTTTGATTGGACTTTTGTTGGCATCATTCTGTGCAAATGTT
TATGTTGACACTGGATTTGTGAACACAGATGATCTGATCATAACTCCCACTGACACTCGT
TGGGTCGGTGCATGGTGGTTTGGCTTTCTGATTTGTGCAGGAGTTAACGTGCTCACTGCC
ATTCCTTTTTTCTTTTTGCCCAACACACTTCCAAAGGAAGGACTAGAGACTAATGCTGAC
ATCATTAAAAATGAAAATGAAGACAAACAAAAAGAAGAGGTCAAGAAGGAAAAATATGGA
ATCACTAAAGATTTTCTACCTTTCATGAAAAGTCTTTCCTGCAATCCAATTTATATGCTT
TTCATACTTGTAAGTGTGATACAGTTCAATGCATTCGTTAACATGATCTCCTTCATGCCT
AAATACCTAGAACAGCAATATGGAATATCATCTTCAGATGCAATCTTTCTAATGGGTATT
TATAACTTACCTCCAATATGTATTGGATATATAATTGGTGGTTTAATTATGAAGAAGTTC
AAGATTACTGTCAAACAAGCTGCCCACATAGGATGTTGGTTATCCTTACTTGAGTATCTT
CTCTATTTTTTATCTTTTCTCATGACTTGTGAAAATTCTTCAGTTGTTGGAATAAATACC
TCTTATGAAGGAATTCCACAAGATTTATATGTGGAAAATGACATCTTTGCTGATTGCAAT
GTGGATTGCAACTGTCCATCTAAAATATGGGATCCTGTGTGTGGAAACAATGGCTTGTCA
TATCTGTCAGCTTGTCTTGCTGGTTGTGAGACATCCATTGGAACGGGAATAAACATGGTG
TTCCAAAATTGCAGCTGTATTCAAACATCAGGAAATTCATCTGCAGTTCTTGGGCTGTGC
GACAAAGGACCTGACTGTTCCTTGATGCTCCAGTACTTCCTAATCTTGTCAGCGATGAGC
AGTTTCATTTATTCTTTGGCTGCCATACCTGGATATATGGTTCTCTTGAGGTGTATGAAA
TCTGAAGAGAAGTCCCTTGGTGTGGGATTACATACATTTTGCACAAGAGTATTTGCTGGC
ATTCCTGCACCTATATATTTTGGCGCTTTAATGGATTCCACATGTTTACACTGGGGAACT
TTGAAATGTGGTGAGTCAGGGGCATGCAGGATATATGATTCCACCACCTTCAGATACATC
TACCTCGGATTGCCGGCAGCACTAAGAGGATCAAGCTTTGTTCCAGCCTTAATCATCTTA
ATTCTTTTGAGGAAGTGTCATCTACCTGGTGAAAATGCCTCTTCAGGAACAGAGCTTATA
GAGACAAAAGTCAAAGGGAAGGAAAATGAGTGCAAAGATATATACCAAAAGTCCACGGTT
TTGAAAGATGATGAATTGAAAACTAAATTGTAA
Protein Properties
Number of Residues 670
Molecular Weight 74144.1
Theoretical pI 5.75
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 21-37
  • 86-106
  • 156-176
  • 194-214
  • 246-266
  • 316-336
  • 356-376
  • 390-410
  • 461-481
  • 513-533
  • 557-577
  • 603-623
Protein Sequence
>Solute carrier organic anion transporter family member 1A2
MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGF
INGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVS
VSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGI
SYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTR
WVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYG
ITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGI
YNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT
SYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMV
FQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMK
SEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYI
YLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTV
LKDDELKTKL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P46721
UniProtKB/Swiss-Prot Entry Name SO1A2_HUMAN
PDB IDs Not Available
GenBank Gene ID U21943
GeneCard ID SLCO1A2
GenAtlas ID SLCO1A2
HGNC ID HGNC:10956
References
General References
  1. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  2. Konig J, Cui Y, Nies AT, Keppler D: Localization and genomic organization of a new hepatocellular organic anion transporting polypeptide. J Biol Chem. 2000 Jul 28;275(30):23161-8. [PubMed:10779507 ]
  3. Kullak-Ublick GA, Hagenbuch B, Stieger B, Schteingart CD, Hofmann AF, Wolkoff AW, Meier PJ: Molecular and functional characterization of an organic anion transporting polypeptide cloned from human liver. Gastroenterology. 1995 Oct;109(4):1274-82. [PubMed:7557095 ]
  4. Speek M: Antisense promoter of human L1 retrotransposon drives transcription of adjacent cellular genes. Mol Cell Biol. 2001 Mar;21(6):1973-85. [PubMed:11238933 ]
  5. Lee W, Glaeser H, Smith LH, Roberts RL, Moeckel GW, Gervasini G, Leake BF, Kim RB: Polymorphisms in human organic anion-transporting polypeptide 1A2 (OATP1A2): implications for altered drug disposition and central nervous system drug entry. J Biol Chem. 2005 Mar 11;280(10):9610-7. Epub 2005 Jan 4. [PubMed:15632119 ]