Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02699
Secondary Accession Numbers
  • 8202
Name Collagen alpha-1(XIII) chain
Synonyms
  1. COLXIIIA1
Gene Name COL13A1
Protein Type Enzyme
Biological Properties
General Function Translation, ribosomal structure and biogenesis
Specific Function Involved in cell-matrix and cell-cell adhesion interactions that are required for normal development. May participate in the linkage between muscle fiber and basement membrane. May play a role in endochondral ossification of bone and branching morphogenesis of lung. Binds heparin
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 10q22
SNPs COL13A1
Gene Sequence
>2154 bp
ATGGTAGCGGAGCGCACCCACAAAGCGGCAGCCACCGGTGCCCGCGGCCCTGGGGAGTTG
GGCGCGCCCGGGACGGTGGCTCTGGTGGCGGCGCGGGCGGAGCGCGGCGCACGGCTGCCG
AGTCCAGGGTCGTGCGGGCTGCTGACGCTGGCCCTCTGCTCGCTGGCACTCAGCCTGCTC
GCCCACTTTCGGACGGCCGAGCTGCAGGCCCGGGTGCTGCGCCTGGAAGCGGAGCGCGGG
GAGCAGCAAATGGAGACAGCTATTTTGGGACGAGTCAATCAACTGCTGGACGAGAAATGG
AAGCTCCACTCAAGGAGGCGCCGGGAGGCCCCAAAGACATCTCCAGGATGTAACTGCCCA
CCAGGACCTCCTGGTCCCACTGGAAGACCCGGACTCCCAGGGGACAAAGGTGCCATTGGG
ATGCCTGGACGTGTGGGGTCCCCCGGAGACGCTGGGCTGTCCATCATTGGTCCCCGCGGC
CCCCCTGGTCAACCAGGCACTAGAGGTTTCCCTGGATTTCCGGGTCCCATTGGGCTGGAC
GGCAAACCGGGCCACCCAGGACCAAAGGGCGACATGGGTCTGACGGGTCCCCCAGGACAG
CCGGGACCCCAGGGACAAAAAGGAGAAAAGGGTCAGTGTGGAGAGTACCCACACCGGGAG
TGCCTAAGCAGCATGCCAGCAGCTCTGCGCTCCAGCCAGATAATTGCCCTGAAGCTGCTG
CCTCTCCTCAATTCAGTGCGACTGGCTCCACCCCCGGTCATAAAAAGGCGGACATTCCAG
GGCGAACAGAGCCAGGCCAGCATCCAAGGTCCACCAGGGCCCCCAGGCCCCCCTGGACCA
AGTGGACCTCTGGGGCACCCAGGACTGCCAGGGCCTATGGGGCCACCTGGCTTACCTGGG
CCTCCTGGACCAAAGGGAGACCCAGGGATCCAGGGCTACCACGGCCGGAAGGGAGAACGG
GGCATGCCAGGGATGCCAGGCAAGCATGGAGCCAAGGGGGCGCCCGGAATTGCCGTGGCT
GGGATGAAGGGTGAGCCAGGGATCCCAGGAACCAAGGGTGAGAAGGGGGCTGAAGGCTCC
CCTGGGCTTCCTGGCCTCCTGGGGCAGAAGGGAGAGAAAGGCGATGCTGGCAACTCCATT
GGAGGAGGCAGAGGGGAACCTGGCCCTCCAGGGCTCCCTGCGCCCCCAGGGCCAAAGGGA
GAAGCAGGTGTCGATGGCCAGGTTGGCCCCCCAGGGCAGCCAGGAGACAAGGGGGAGCGT
GGAGCAGCTGGAGAACAGGGACCAGATGGCCCCAAGGGCTCCAAGGGAGAACCAGGGAAA
GGAGAGATGGTGGATTACAATGGAAACATCAATGAGGCTCTCCAGGAGATCCGGACGCTG
GCCTTGATGGGGCCTCCTGGTCTTCCTGGGCAAATTGGCCCACCTGGAGCTCCAGGGATT
CCAGGCCAGAAGGGGGAGATTGGACTGCCAGGCCCTCCAGGACACGATGGGGAAAAGGGA
CCTCGCGGTAAACCAGGAGACATGGGCCCTCCTGGTCCCCAAGGCCCCCCAGGAAAGGAT
GGACCTCCAGGAGTGAAGGGAGAAAACGGGCACCCAGGGAGCCCAGGAGAGAAGGGGGAA
AAAGGGGAGACAGGACAAGCAGGCTCACCGGGAGAGAAAGGAGAAGCCGGGGAGAAGGGC
AATCCAGGAGCAGAGGTTCCTGGGCTGCCAGGGCCAGAGGGGCCTCCCGGACCTCCGGGG
CTCCAAGGTGTTCCTGGACCAAAGGGGGAAGCAGGACTAGATGGAGCAAAAGGAGAGAAA
GGCTTCCAGGGAGAAAAAGGAGACCGTGGTCCCCTGGGACTACCCGGAGCTTCAGGTTTG
GACGGCAGGCCTGGGCCACCGGGTACTCCAGGACCAATTGGAGTTCCAGGCCCAGCGGGA
CCAAAGGGCGAGAGGGGCAGCAAAGGAGACCCTGGGATGACAGGACCAACGGGAGCAGCT
GGGCTTCCTGGTTTACATGGACCACCCGGGGACAAGGGAAACCGGGGGGAGAGGGGGAAG
AAAGGCTCTAGAGGGCCTAAAGGGGACAAGGGAGACCAAGGAGCGCCTGGATTAGATGCC
CCCTGCCCATTGGGCGAAGATGGCTTACCAGTCCAAGGCTGCTGGAACAAGTGA
Protein Properties
Number of Residues 717
Molecular Weight 69949.7
Theoretical pI 9.82
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 45-61
Protein Sequence
>Collagen alpha-1(XIII) chain
MVAERTHKAAATGARGPGELGAPGTVALVAARAERGARLPSPGSCGLLTLALCSLALSLL
AHFRTAELQARVLRLEAERGEQQMETAILGRVNQLLDEKWKLHSRRRREAPKTSPGCNCP
PGPPGPTGRPGLPGDKGAIGMPGRVGSPGDAGLSIIGPRGPPGQPGTRGFPGFPGPIGLD
GKPGHPGPKGDMGLTGPPGQPGPQGQKGEKGQCGEYPHRECLSSMPAALRSSQIIALKLL
PLLNSVRLAPPPVIKRRTFQGEQSQASIQGPPGPPGPPGPSGPLGHPGLPGPMGPPGLPG
PPGPKGDPGIQGYHGRKGERGMPGMPGKHGAKGAPGIAVAGMKGEPGIPGTKGEKGAEGS
PGLPGLLGQKGEKGDAGNSIGGGRGEPGPPGLPGPPGPKGEAGVDGQVGPPGQPGDKGER
GAAGEQGPDGPKGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLPGQIGPPGAPGI
PGQKGEIGLPGPPGHDGEKGPRGKPGDMGPPGPQGPPGKDGPPGVKGENGHPGSPGEKGE
KGETGQAGSPGEKGEAGEKGNPGAEVPGLPGPEGPPGPPGLQGVPGPKGEAGLDGAKGEK
GFQGEKGDRGPLGLPGASGLDGRPGPPGTPGPIGVPGPAGPKGERGSKGDPGMTGPTGAA
GLPGLHGPPGDKGNRGERGKKGSRGPKGDKGDQGAPGLDAPCPLGEDGLPVQGCWNK
GenBank ID Protein 9650749
UniProtKB/Swiss-Prot ID Q5TAT6
UniProtKB/Swiss-Prot Entry Name CODA1_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ293624
GeneCard ID COL13A1
GenAtlas ID COL13A1
HGNC ID HGNC:2190
References
General References
  1. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  2. Tu H, Sasaki T, Snellman A, Gohring W, Pirila P, Timpl R, Pihlajaniemi T: The type XIII collagen ectodomain is a 150-nm rod and capable of binding to fibronectin, nidogen-2, perlecan, and heparin. J Biol Chem. 2002 Jun 21;277(25):23092-9. Epub 2002 Apr 15. [PubMed:11956183 ]
  3. Snellman A, Tu H, Vaisanen T, Kvist AP, Huhtala P, Pihlajaniemi T: A short sequence in the N-terminal region is required for the trimerization of type XIII collagen and is conserved in other collagenous transmembrane proteins. EMBO J. 2000 Oct 2;19(19):5051-9. [PubMed:11013208 ]
  4. Pihlajaniemi T, Tamminen M: The alpha 1 chain of type XIII collagen consists of three collagenous and four noncollagenous domains, and its primary transcript undergoes complex alternative splicing. J Biol Chem. 1990 Oct 5;265(28):16922-8. [PubMed:1698771 ]
  5. Pihlajaniemi T, Myllyla R, Seyer J, Kurkinen M, Prockop DJ: Partial characterization of a low molecular weight human collagen that undergoes alternative splicing. Proc Natl Acad Sci U S A. 1987 Feb;84(4):940-4. [PubMed:3547403 ]
  6. Tikka L, Pihlajaniemi T, Henttu P, Prockop DJ, Tryggvason K: Gene structure for the alpha 1 chain of a human short-chain collagen (type XIII) with alternatively spliced transcripts and translation termination codon at the 5' end of the last exon. Proc Natl Acad Sci U S A. 1988 Oct;85(20):7491-5. [PubMed:2459707 ]
  7. Juvonen M, Pihlajaniemi T: Characterization of the spectrum of alternative splicing of alpha 1 (XIII) collagen transcripts in HT-1080 cells and calvarial tissue resulted in identification of two previously unidentified alternatively spliced sequences, one previously unidentified exon, and nine new mRNA variants. J Biol Chem. 1992 Dec 5;267(34):24693-9. [PubMed:1447209 ]
  8. Juvonen M, Sandberg M, Pihlajaniemi T: Patterns of expression of the six alternatively spliced exons affecting the structures of the COL1 and NC2 domains of the alpha 1(XIII) collagen chain in human tissues and cell lines. J Biol Chem. 1992 Dec 5;267(34):24700-7. [PubMed:1447210 ]
  9. Juvonen M, Pihlajaniemi T, Autio-Harmainen H: Location and alternative splicing of type XIII collagen RNA in the early human placenta. Lab Invest. 1993 Nov;69(5):541-51. [PubMed:8246446 ]
  10. Sandberg-Lall M, Hagg PO, Wahlstrom I, Pihlajaniemi T: Type XIII collagen is widely expressed in the adult and developing human eye and accentuated in the ciliary muscle, the optic nerve and the neural retina. Exp Eye Res. 2000 Apr;70(4):401-10. [PubMed:10865988 ]