You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02740
Secondary Accession Numbers
  • 8245
Name Hemoglobin subunit gamma-2
Synonyms
  1. Gamma-2-globin
  2. Hb F Ggamma
  3. Hemoglobin gamma-2 chain
  4. Hemoglobin gamma-G chain
Gene Name HBG2
Protein Type Unknown
Biological Properties
General Function Involved in iron ion binding
Specific Function Gamma chains make up the fetal hemoglobin F, in combination with alpha chains
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
hemoglobin complex
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
iron ion binding
heme binding
oxygen binding
Process
establishment of localization
transport
gas transport
oxygen transport
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 11p15.5
SNPs HBG2
Gene Sequence
>444 bp
ATGGGTCATTTCACAGAGGAGGACAAGGCTACTATCACAAGCCTGTGGGGCAAGGTGAAT
GTGGAAGATGCTGGAGGAGAAACCCTGGGAAGGCTCCTGGTTGTCTACCCATGGACCCAG
AGGTTCTTTGACAGCTTTGGCAACCTGTCCTCTGCCTCTGCCATCATGGGCAACCCCAAA
GTCAAGGCACATGGCAAGAAGGTGCTGACTTCCTTGGGAGATGCCATAAAGCACCTGGAT
GATCTCAAGGGCACCTTTGCCCAGCTGAGTGAACTGCACTGTGACAAGCTGCATGTGGAT
CCTGAGAACTTCAAGCTCCTGGGAAATGTGCTGGTGACCGTTTTGGCAATCCATTTCGGC
AAAGAATTCACCCCTGAGGTGCAGGCTTCCTGGCAGAAGATGGTGACTGGAGTGGCCAGT
GCCCTGTCCTCCAGATACCACTGA
Protein Properties
Number of Residues 147
Molecular Weight 16126.3
Theoretical pI 7.23
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Hemoglobin subunit gamma-2
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPK
VKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFG
KEFTPEVQASWQKMVTGVASALSSRYH
GenBank ID Protein 158254416
UniProtKB/Swiss-Prot ID P69892
UniProtKB/Swiss-Prot Entry Name HBG2_HUMAN
PDB IDs
GenBank Gene ID AK290492
GeneCard ID HBG2
GenAtlas ID HBG2
HGNC ID HGNC:4832
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  4. Lang KM, Spritz RA: Cloning specific complete polyadenylylated 3'-terminal cDNA segments. Gene. 1985;33(2):191-6. [PubMed:2581851 ]
  5. Slightom JL, Blechl AE, Smithies O: Human fetal G gamma- and A gamma-globin genes: complete nucleotide sequences suggest that DNA can be exchanged between these duplicated genes. Cell. 1980 Oct;21(3):627-38. [PubMed:7438203 ]
  6. Stegink LD, Meyer PD, Brummel MC: Human fetal hemoglobin F 1. Acetylation status. J Biol Chem. 1971 May 10;246(9):3001-7. [PubMed:5554303 ]
  7. Cavallesco C, Forget BG, deRiel JK, Wilson LB, Wilson JT, Weissman SM: Nucleotide sequence of human G gamma globin messenger RNA. Gene. 1980 Dec;12(3-4):215-21. [PubMed:7250702 ]
  8. SCHROEDER WA, SHELTON JR, SHELTON JB, CORMICK J, JONES RT: THE AMINO ACID SEQUENCE OF THE GAMMA CHAIN OF HUMAN FETAL HEMOGLOBIN. Biochemistry. 1963 Sep-Oct;2:992-1008. [PubMed:14087393 ]
  9. Frier JA, Perutz MF: Structure of human foetal deoxyhaemoglobin. J Mol Biol. 1977 May 5;112(1):97-112. [PubMed:881729 ]
  10. Cauchi MN, Clegg JB, Weatherall DJ: Haemoglobin F(Malta): a new foetal haemoglobin variant with a high incidence in Maltese infants. Nature. 1969 Jul 19;223(5203):311-3. [PubMed:5792729 ]
  11. Carrell RW, Owen MC, Anderson R, Berry E: Haemoglobin F auckland G gamma 7 Asp leads to Asn: further evidence for multiple genes for the gamma chain. Biochim Biophys Acta. 1974 Oct 9;365(2):323-7. [PubMed:4429671 ]
  12. Brimhall B, Vedvick TS, Jones RT, Ahern E, Palomino E, Ahern V: Haemoglobin F Port Royal (alpha2G gamma2 125 Glu leads to Ala). Br J Haematol. 1974 Jun;27(2):313-8. [PubMed:4846278 ]
  13. Eng LI, Kamuzora H, Lehmann H: Haemoglobin F Malaysia: alpha 2, gamma 2 1(NA1) glycine--cysteine; 136 glycine. J Med Genet. 1974 Mar;11(1):25-30. [PubMed:4837284 ]
  14. Lee-Potter JP, Deacon-Smith RA, Simpkiss MJ, Kamuzora H, Lehmann H: A new cause of haemolytic anaemia in the newborn. A description of an unstable fetal haemoglobin: F Poole, alpha2-G-gamma2 130 trptophan yeilds glycine. J Clin Pathol. 1975 Apr;28(4):317-20. [PubMed:1127124 ]
  15. Brennan SO, Smith MB, Carrell RW: Haemoglobin F Melbourne Ggamma 16 Gly leads to Arg and haemoglobin F carlton Ggamma 121 Glu leads to Lys. Further evidence for varied activity of gamma-chain genes. Biochim Biophys Acta. 1977 Feb 22;490(2):452-5. [PubMed:836882 ]
  16. Ohta Y, Saito S, Fujita S, Wilson JB, Lam H, Huisman TH: Hb F-Meinohama or alpha 2 gamma 2 (5 Glu replaced by Gly; 75 Ile; 136 Gly). Hemoglobin. 1981;5(6):565-70. [PubMed:6172403 ]
  17. Honig GR, Koshy M, Schroeder WA, Shelton JB, Shelton JR: Hemoglobin F Lodz (G gamma I 44 Ser replaced by Arg). A newly identified variant from an American infant of Polish descent. Biochim Biophys Acta. 1982 Oct 5;707(2):213-6. [PubMed:6814491 ]
  18. Serjeant GR, Serjeant BE, Lehmann H, Dukes M, Robb L: Hb F Kingston (G gamma 55 [D6] Met leads to Arg). FEBS Lett. 1982 Dec 13;150(1):77-80. [PubMed:6186522 ]
  19. Shelton JB, Shelton JR, Espinueva Z, Huynh V, Schroeder WA, Powars D: Hemoglobin F-Caltech: alpha 2 G gamma 2 120Lys replaced by Gln. Hemoglobin. 1982;6(6):577-92. [PubMed:6186635 ]
  20. Nakatsuji T, Lam H, Wilson JB, Webber BB, Huisman TH: Hb F-Columbus-Ga or alpha 2 G gamma 2 94(FGl) Asp replaced by Asn. Hemoglobin. 1982;6(6):593-8. [PubMed:6186636 ]
  21. Nakatsuji T, Lam H, Huisman TH: Hb F-Kennestone or alpha 2G gamma 2 (EF1)77 His leads to Arg observed in a Caucasian baby. Hemoglobin. 1983;7(3):267-70. [PubMed:6192110 ]
  22. Nakatsuji T, Shimizu K, Huisman TH: Hb F-La Grange or alpha 2 gamma 2 101(G3)Glu----Lys; 75Ile; 136Gly: a high oxygen affinity fetal hemoglobin variant observed in a Caucasian newborn. Biochim Biophys Acta. 1984 Sep 11;789(2):224-8. [PubMed:6206897 ]
  23. Zeng YT, Huang SZ, Nakatsuji T, Huisman TH: -G gamma A gamma-Thalassemia and gamma-chain variants in Chinese newborn babies. Am J Hematol. 1985 Mar;18(3):235-42. [PubMed:2579547 ]
  24. Chen S, Wilson JB, Webber BB, Huisman TH, Miwa S, Amenomori Y: Hb F-Tokyo or alpha 2G gamma 2 34(B16)Val----Ile, a silent gamma chain variant detected by reverse phase high performance liquid chromatography. Hemoglobin. 1985;9(1):25-32. [PubMed:2581919 ]
  25. Hu HY, Ma MS: Hb F-Urumqi G gamma I22(B4)Asp----Gly: a new fetal hemoglobin variant found in a Uygur baby. Hemoglobin. 1986;10(1):15-20. [PubMed:2420748 ]
  26. de Pablos JM, Wilson JB, Kutlar A, Chen SS, Huisman TH: Hb F-Albaicin or G gamma 8(A5)Lys----Glu or Gln. Hemoglobin. 1986;10(6):655-9. [PubMed:2435680 ]
  27. Hayashi A, Wada Y, Matsuo T, Katakuse I, Matsuda H: Neonatal screening and mass-spectrometric analysis of hemoglobin variants in Japan. Acta Haematol. 1987;78(2-3):114-8. [PubMed:3120456 ]
  28. Kleman K, Lubin B, Wilson JB, Kutlar A, Webber BB, Huisman TH: Hb F-Oakland or alpha 2G gamma I2(26)(B8)Glu----Lys. Hemoglobin. 1987;11(2):181-3. [PubMed:2442122 ]
  29. Kutlar A, Kutlar F, Wilson JB, Webber BB, Gonzalez Redondo JM, Huisman TH: Hb F-Clarke or alpha 2G gamma 2(65)(E9)Lys----Asn. Hemoglobin. 1987;11(2):185-8. [PubMed:2442123 ]
  30. de Pablos JM, Clegg JB: Hb F-Granada or alpha 2G gamma (2)22(B4)Asp----Val: a new human fetal hemoglobin variant. Hemoglobin. 1988;12(4):405-7. [PubMed:2459082 ]
  31. Kutlar A, Kutlar F, Wilson JB, Webber BB, Hu H, Huisman TH: Hb F-Austell or alpha 2G gamma (2)40(C6)Arg----Lys. Hemoglobin. 1988;12(4):409-11. [PubMed:2459083 ]
  32. Glader BE, Zwerdling D, Kutlar F, Kutlar A, Wilson JB, Huisman TH: Hb F-M-Osaka or alpha 2G gamma 2(63)(E7)His----Tyr in a Caucasian male infant. Hemoglobin. 1989;13(7-8):769-73. [PubMed:2483933 ]
  33. Priest JR, Watterson J, Jones RT, Faassen AE, Hedlund BE: Mutant fetal hemoglobin causing cyanosis in a newborn. Pediatrics. 1989 May;83(5):734-6. [PubMed:2470017 ]
  34. Plaseska D, Li HJ, Wilson JB, Kutlar F, Kutlar A, Huisman TH, Kulpa J: Hb F-Brooklyn or alpha 2G gamma 2(66)(E10)Lys----Gln. Hemoglobin. 1990;14(2):213-6. [PubMed:1703138 ]
  35. Harano T, Harano K, Doi K, Ueda S, Imai K, Ohba Y, Kutlar F, Huisman TH: Hb F-Onoda or alpha 2G gamma 2(146)(HC3)His----Tyr, a newly discovered fetal hemoglobin variant in a Japanese newborn. Hemoglobin. 1990;14(2):217-22. [PubMed:1703139 ]
  36. Plaseska D, Wilson JB, Kutlar F, Font L, Baiget M, Huisman TH: Hb F-Catalonia or alpha 2G gamma(2)15(A12)Trp----Arg. Hemoglobin. 1990;14(5):511-6. [PubMed:1706691 ]
  37. Plaseska D, Kutlar F, Wilson JB, Fei YJ, Huisman TH: Hb F-Charlotte, an A gamma variant with a threonine residue in position gamma 75 and a glycine residue in position gamma 136. Hemoglobin. 1990;14(6):617-25. [PubMed:1714434 ]
  38. Qualtieri A, Crescibene L, Bagala A, De Marco EV, Bria M, Brancati C: Hb F-Cosenza or G gamma 25(B7)Gly----Glu: a new fast-moving fetal hemoglobin variant. Hemoglobin. 1991;15(6):509-15. [PubMed:1726095 ]
  39. Pobedimskaya DD, Molchanova TP, Huisman TH, Harding SR, Bakanec R: Hb F-Saskatoon or alpha 2G gamma (2)21(B3)Glu-->Lys observed in a North American Indian newborn. Hemoglobin. 1993 Dec;17(6):547-9. [PubMed:8144355 ]
  40. Plaseska D, Panovska-Popovska S, Lazarevski M, Efremov GD: Hb F-Macedonia-II [G gamma 104(G6)Lys-->Asn]: a new gamma chain variant. Hemoglobin. 1994 Nov;18(6):373-82. [PubMed:7713741 ]
  41. Kohli-Kumar M, Zwerdling T, Rucknagel DL: Hemoglobin F-Cincinnati, alpha 2G gamma 2 41(C7) Phe-->Ser in a newborn with cyanosis. Am J Hematol. 1995 May;49(1):43-7. [PubMed:7741137 ]
  42. Abbes S, Fitzgerald PA, Varady E, Girot R, Pic P, Blouquit Y, Ducrocq R, Drupt F, Wajcman H: Two fetal hemoglobin variants affecting the same residue: Hb F-Emirates [G gamma 59(E3)Lys-->Glu] and Hb F-Sacromonte [G gamma 59(E3)Lys-->Gln]. Hemoglobin. 1995 May-Jul;19(3-4):173-82. [PubMed:7558873 ]
  43. de Pablos Gallego JM, Gu LH, Leonova JYe, Huisman TH: Hb F-Veleta or alpha 2 G gamma(2)40(C6)Arg-->Gly. Hemoglobin. 1995;19(6):407-11. [PubMed:8718700 ]
  44. Gu LH, Oner C, Huisman TH: The G gamma T chain (G gamma 75 Thr; 136 Gly) in Hb F-Charlotte is the product of an A gamma gene with a limited gene conversion and that in Hb F-Waynesboro of a mutated G gamma gene. Hemoglobin. 1995;19(6):413-8. [PubMed:8718701 ]
  45. Papadakis MN, Patrinos GP, Drakoulakou O, Loutradi-Anagnostou A: HbF-Lesvos: an HbF variant due to a novel G gamma mutation (:G gamma 75 ATA-->ACA) detected in a Greek family. Hum Genet. 1996 Feb;97(2):260-2. [PubMed:8566966 ]
  46. Manca L, Cherchi L, De Rosa MC, Giardina B, Masala B: A new, electrophoretically silent, fetal hemoglobin variant: Hb F-Calabria [Ggamma118(GH1)Phe-->Leu]. Hemoglobin. 2000 Feb;24(1):37-44. [PubMed:10722114 ]
  47. Wajcman H, Borensztajn K, Riou J, Prome D, Hurtrel D, Bardakdjian J, Lena-Russo D, Amouroux I, Ducrocq R: Two new Ggamma chain variants: Hb F-clamart [gamma17(A14)Lys-->Asn] and Hb F-Ouled Rabah [gamma19(B1)Asn-->Lys]. Hemoglobin. 2000 Feb;24(1):45-52. [PubMed:10722115 ]
  48. Wajcman H, Yapo AP, Riou J, Prome D, Richelme-David S, Hurtrel D, Bardakdjian-Michau J: A new Ggamma chain variant: Hb F-Coignieres [gamma75(E19)Ile-->Val]. Hemoglobin. 2001 Nov;25(4):425-8. [PubMed:11791877 ]
  49. Van den Driessche M, Moerman J, Moens M, Van Eldere S, Derclaye I, Philippe M: Severe hereditary haemolytic anaemia in a Caucasian newborn: a new fetal haemoglobin variant Hb F-Bonheiden ((G)gamma 38(C4) Thr-->Pro). Eur J Pediatr. 2005 Apr;164(4):261-2. Epub 2005 Jan 12. [PubMed:15645283 ]
  50. Lacan P, Burnichon N, Becchi M, Zanella-Cleon I, Aubry M, Couprie N, Francina A: A new G(gamma) chain variant: Hb F-Bron [gamma20(B2)val-->Ala]. Hemoglobin. 2005;29(4):301-5. [PubMed:16370494 ]