You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02749
Secondary Accession Numbers
  • 8254
Name Solute carrier family 15 member 1
Synonyms
  1. Intestinal H(+)/peptide cotransporter
  2. Oligopeptide transporter, small intestine isoform
  3. Peptide transporter 1
Gene Name SLC15A1
Protein Type Transporter
Biological Properties
General Function Involved in transporter activity
Specific Function Proton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides. May constitute a major route for the absorption of protein digestion end-products
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
peptide transporter activity
oligopeptide transporter activity
transporter activity
substrate-specific transporter activity
Process
peptide transport
oligopeptide transport
establishment of localization
transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 13q33-q34
SNPs SLC15A1
Gene Sequence
>2127 bp
ATGGGAATGTCCAAATCACACAGTTTCTTTGGTTATCCCCTGAGCATCTTCTTCATCGTG
GTCAATGAGTTTTGCGAAAGATTTTCCTACTATGGAATGCGAGCAATCCTGATTCTGTAC
TTCACAAATTTCATCAGCTGGGATGATAACCTGTCCACCGCCATCTACCATACGTTTGTG
GCTCTGTGCTACCTGACGCCAATTCTCGGAGCTCTTATCGCCGACTCGTGGCTGGGAAAG
TTCAAGACCATTGTGTCGCTCTCCATTGTCTACACAATTGGACAAGCAGTCACCTCAGTA
AGCTCCATTAATGACCTCACAGACCACAACCATGATGGCACCCCCGACAGCCTTCCTGTG
CACGTGGTGCTGTCCTTGATCGGCCTGGCCCTGATAGCTCTCGGGACTGGAGGAATCAAA
CCCTGTGTGTCTGCGTTTGGTGGAGATCAGTTTGAAGAGGGCCAGGAGAAACAAAGAAAC
AGATTTTTTTCCATCTTTTACTTGGCTATTAATGCTGGAAGTTTGCTTTCCACAATCATC
ACACCCATGCTCAGAGTTCAACAATGTGGAATTCACAGTAAACAAGCTTGTTACCCACTG
GCCTTTGGGGTTCCTGCTGCTCTCATGGCTGTAGCCCTGATTGTGTTTGTCCTTGGCAGT
GGGATGTACAAGAAGTTCAAGCCACAGGGCAACATCATGGGTAAAGTGGCCAAGTGCATC
GGTTTTGCCATCAAAAATAGATTTAGGCATCGGAGTAAGGCATTTCCCAAGAGGGAGCAC
TGGCTGGACTGGGCTAAAGAGAAATACGATGAGCGGCTCATCTCCCAAATTAAGATGGTT
ACGAGGGTGATGTTCCTGTATATTCCACTCCCAATGTTCTGGGCCTTGTTTGACCAGCAG
GGCTCCAGGTGGACACTGCAGGCAACAACTATGTCCGGGAAAATCGGAGCTCTTGAAATT
CAGCCCGATCAGATGCAGACCGTGAACGCCATCCTGATCGTGATCATGGTCCCGATCTTC
GATGCTGTGCTGTACCCTCTCATTGCAAAATGTGGCTTCAATTTCACCTCCTTGAAGAAG
ATGGCAGTTGGCATGGTCCTGGCCTCCATGGCCTTTGTGGTGGCTGCCATCGTGCAGGTG
GAAATCGATAAAACTCTTCCAGTCTTCCCCAAAGGAAACGAAGTCCAAATTAAAGTTTTG
AATATAGGAAACAATACCATGAATATATCTCTTCCTGGAGAGATGGTGACACTTGGCCCA
ATGTCTCAAACAAATGCATTTATGACTTTTGATGTAAACAAACTGACAAGGATAAACATT
TCTTCTCCTGGATCACCAGTCACTGCTGTAACTGACGACTTCAAGCAGGGCCAACGCCAC
ACGCTTCTAGTGTGGGCCCCCAATCACTACCAGGTGGTAAAGGATGGTCTTAACCAGAAG
CCAGAAAAAGGGGAAAATGGAATCAGATTTGTAAATACTTTTAACGAGCTCATCACCATC
ACAATGAGTGGGAAAGTTTATGCAAACATCAGCAGCTACAATGCCAGCACATACCAGTTT
TTTCCTTCTGGCATAAAAGGCTTCACAATAAGCTCAACAGAGATTCCGCCACAATGTCAA
CCTAATTTCAATACTTTCTACCTTGAATTTGGTAGTGCTTATACCTATATAGTCCAAAGG
AAGAATGACAGCTGCCCTGAAGTGAAGGTGTTTGAAGATATTTCAGCCAACACAGTTAAC
ATGGCTCTGCAAATCCCGCAGTATTTTCTTCTCACCTGTGGCGAAGTGGTCTTCTCTGTC
ACGGGATTGGAATTCTCATATTCTCAGGCTCCTTCCAACATGAAGTCGGTGCTTCAGGCA
GGATGGCTGCTGACCGTGGCTGTTGGCAACATCATTGTGCTCATCGTGGCAGGGGCAGGC
CAGTTCAGCAAACAGTGGGCCGAGTACATTCTATTTGCCGCGTTGCTTCTGGTCGTCTGT
GTAATTTTTGCCATCATGGCTCGGTTCTATACTTACATCAACCCAGCGGAGATCGAAGCT
CAATTTGATGAGGATGAAAAGAAAAACAGACTGGAAAAGAGTAACCCATATTTCATGTCA
GGGGCCAATTCACAGAAACAGATGTGA
Protein Properties
Number of Residues 708
Molecular Weight 78805.3
Theoretical pI 8.64
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 1-21
  • 54-74
  • 83-103
  • 119-139
  • 162-182
  • 199-219
  • 277-297
  • 328-348
  • 362-382
  • 585-605
  • 620-640
  • 646-666
Protein Sequence
>Solute carrier family 15 member 1
MGMSKSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPV
HVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII
TPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCI
GFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQ
GSRWTLQATTMSGKIGALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKK
MAVGMVLASMAFVVAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGP
MSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQK
PEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQ
PNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSV
TGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVC
VIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMSGANSQKQM
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P46059
UniProtKB/Swiss-Prot Entry Name S15A1_HUMAN
PDB IDs Not Available
GenBank Gene ID U13173
GeneCard ID SLC15A1
GenAtlas ID SLC15A1
HGNC ID HGNC:10920
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  3. Saito S, Iida A, Sekine A, Ogawa C, Kawauchi S, Higuchi S, Nakamura Y: Catalog of 238 variations among six human genes encoding solute carriers ( hSLCs) in the Japanese population. J Hum Genet. 2002;47(11):576-84. [PubMed:12436193 ]
  4. Liang R, Fei YJ, Prasad PD, Ramamoorthy S, Han H, Yang-Feng TL, Hediger MA, Ganapathy V, Leibach FH: Human intestinal H+/peptide cotransporter. Cloning, functional expression, and chromosomal localization. J Biol Chem. 1995 Mar 24;270(12):6456-63. [PubMed:7896779 ]
  5. Anderle P, Nielsen CU, Pinsonneault J, Krog PL, Brodin B, Sadee W: Genetic variants of the human dipeptide transporter PEPT1. J Pharmacol Exp Ther. 2006 Feb;316(2):636-46. Epub 2005 Oct 28. [PubMed:16258023 ]