You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02761
Secondary Accession Numbers
  • 8267
Name Toll-like receptor 9
Synonyms
  1. CD289 antigen
Gene Name TLR9
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
Function
binding
receptor activity
transmembrane receptor activity
protein binding
molecular transducer activity
signal transducer activity
Process
defense response
response to stimulus
response to stress
innate immune response
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Cellular Location
  1. Lysosome
  2. Cytoplasmic vesicle
  3. Endoplasmic reticulum membrane
  4. Single-pass type I membrane protein
  5. Endosome
  6. phagosome
Gene Properties
Chromosome Location Chromosome:3
Locus 3p21.3
SNPs TLR9
Gene Sequence
>3099 bp
ATGGGTTTCTGCCGCAGCGCCCTGCACCCGCTGTCTCTCCTGGTGCAGGCCATCATGCTG
GCCATGACCCTGGCCCTGGGTACCTTGCCTGCCTTCCTACCCTGTGAGCTCCAGCCCCAC
GGCCTGGTGAACTGCAACTGGCTGTTCCTGAAGTCTGTGCCCCACTTCTCCATGGCAGCA
CCCCGTGGCAATGTCACCAGCCTTTCCTTGTCCTCCAACCGCATCCACCACCTCCATGAT
TCTGACTTTGCCCACCTGCCCAGCCTGCGGCATCTCAACCTCAAGTGGAACTGCCCGCCG
GTTGGCCTCAGCCCCATGCACTTCCCCTGCCACATGACCATCGAGCCCAGCACCTTCTTG
GCTGTGCCCACCCTGGAAGAGCTAAACCTGAGCTACAACAACATCATGACTGTGCCTGCG
CTGCCCAAATCCCTCATATCCCTGTCCCTCAGCCATACCAACATCCTGATGCTAGACTCT
GCCAGCCTCGCCGGCCTGCATGCCCTGCGCTTCCTATTCATGGACGGCAACTGTTATTAC
AAGAACCCCTGCAGGCAGGCACTGGAGGTGGCCCCGGGTGCCCTCCTTGGCCTGGGCAAC
CTCACCCACCTGTCACTCAAGTACAACAACCTCACTGTGGTGCCCCGCAACCTGCCTTCC
AGCCTGGAGTATCTGCTGTTGTCCTACAACCGCATCGTCAAACTGGCGCCTGAGGACCTG
GCCAATCTGACCGCCCTGCGTGTGCTCGATGTGGGCGGAAATTGCCGCCGCTGCGACCAC
GCTCCCAACCCCTGCATGGAGTGCCCTCGTCACTTCCCCCAGCTACATCCCGATACCTTC
AGCCACCTGAGCCGTCTTGAAGGCCTGGTGTTGAAGGACAGTTCTCTCTCCTGGCTGAAT
GCCAGTTGGTTCCGTGGGCTGGGAAACCTCCGAGTGCTGGACCTGAGTGAGAACTTCCTC
TACAAATGCATCACTAAAACCAAGGCCTTCCAGGGCCTAACACAGCTGCGCAAGCTTAAC
CTGTCCTTCAATTACCAAAAGAGGGTGTCCTTTGCCCACCTGTCTCTGGCCCCTTCCTTC
GGGAGCCTGGTCGCCCTGAAGGAGCTGGACATGCACGGCATCTTCTTCCGCTCACTCGAT
GAGACCACGCTCCGGCCACTGGCCCGCCTGCCCATGCTCCAGACTCTGCGTCTGCAGATG
AACTTCATCAACCAGGCCCAGCTCGGCATCTTCAGGGCCTTCCCTGGCCTGCGCTACGTG
GACCTGTCGGACAACCGCATCAGCGGAGCTTCGGAGCTGACAGCCACCATGGGGGAGGCA
GATGGAGGGGAGAAGGTCTGGCTGCAGCCTGGGGACCTTGCTCCGGCCCCAGTGGACACT
CCCAGCTCTGAAGACTTCAGGCCCAACTGCAGCACCCTCAACTTCACCTTGGATCTGTCA
CGGAACAACCTGGTGACCGTGCAGCCGGAGATGTTTGCCCAGCTCTCGCACCTGCAGTGC
CTGCGCCTGAGCCACAACTGCATCTCGCAGGCAGTCAATGGCTCCCAGTTCCTGCCGCTG
ACCGGTCTGCAGGTGCTAGACCTGTCCCACAATAAGCTGGACCTCTACCACGAGCACTCA
TTCACGGAGCTACCACGACTGGAGGCCCTGGACCTCAGCTACAACAGCCAGCCCTTTGGC
ATGCAGGGCGTGGGCCACAACTTCAGCTTCGTGGCTCACCTGCGCACCCTGCGCCACCTC
AGCCTGGCCCACAACAACATCCACAGCCAAGTGTCCCAGCAGCTCTGCAGTACGTCGCTG
CGGGCCCTGGACTTCAGCGGCAATGCACTGGGCCATATGTGGGCCGAGGGAGACCTCTAT
CTGCACTTCTTCCAAGGCCTGAGCGGTTTGATCTGGCTGGACTTGTCCCAGAACCGCCTG
CACACCCTCCTGCCCCAAACCCTGCGCAACCTCCCCAAGAGCCTACAGGTGCTGCGTCTC
CGTGACAATTACCTGGCCTTCTTTAAGTGGTGGAGCCTCCACTTCCTGCCCAAACTGGAA
GTCCTCGACCTGGCAGGAAACCAGCTGAAGGCCCTGACCAATGGCAGCCTGCCTGCTGGC
ACCCGGCTCCGGAGGCTGGATGTCAGCTGCAACAGCATCAGCTTCGTGGCCCCCGGCTTC
TTTTCCAAGGCCAAGGAGCTGCGAGAGCTCAACCTTAGCGCCAACGCCCTCAAGACAGTG
GACCACTCCTGGTTTGGGCCCCTGGCGAGTGCCCTGCAAATACTAGATGTAAGCGCCAAC
CCTCTGCACTGCGCCTGTGGGGCGGCCTTTATGGACTTCCTGCTGGAGGTGCAGGCTGCC
GTGCCCGGTCTGCCCAGCCGGGTGAAGTGTGGCAGTCCGGGCCAGCTCCAGGGCCTCAGC
ATCTTTGCACAGGACCTGCGCCTCTGCCTGGATGAGGCCCTCTCCTGGGACTGTTTCGCC
CTCTCGCTGCTGGCTGTGGCTCTGGGCCTGGGTGTGCCCATGCTGCATCACCTCTGTGGC
TGGGACCTCTGGTACTGCTTCCACCTGTGCCTGGCCTGGCTTCCCTGGCGGGGGCGGCAA
AGTGGGCGAGATGAGGATGCCCTGCCCTACGATGCCTTCGTGGTCTTCGACAAAACGCAG
AGCGCAGTGGCAGACTGGGTGTACAACGAGCTTCGGGGGCAGCTGGAGGAGTGCCGTGGG
CGCTGGGCACTCCGCCTGTGCCTGGAGGAACGCGACTGGCTGCCTGGCAAAACCCTCTTT
GAGAACCTGTGGGCCTCGGTCTATGGCAGCCGCAAGACGCTGTTTGTGCTGGCCCACACG
GACCGGGTCAGTGGTCTCTTGCGCGCCAGCTTCCTGCTGGCCCAGCAGCGCCTGCTGGAG
GACCGCAAGGACGTCGTGGTGCTGGTGATCCTGAGCCCTGACGGCCGCCGCTCCCGCTAC
GTGCGGCTGCGCCAGCGCCTCTGCCGCCAGAGTGTCCTCCTCTGGCCCCACCAGCCCAGT
GGTCAGCGCAGCTTCTGGGCCCAGCTGGGCATGGCCCTGACCAGGGACAACCACCACTTC
TATAACCGGAACTTCTGCCAGGGACCCACGGCCGAATAG
Protein Properties
Number of Residues 1032
Molecular Weight 115858.7
Theoretical pI 8.23
Pfam Domain Function
Signals
  • 1-25
Transmembrane Regions
  • 819-839
Protein Sequence
>Toll-like receptor 9
MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE
GenBank ID Protein 8099652
UniProtKB/Swiss-Prot ID Q9NR96
UniProtKB/Swiss-Prot Entry Name TLR9_HUMAN
PDB IDs Not Available
GenBank Gene ID AF259262
GeneCard ID TLR9
GenAtlas ID TLR9
HGNC ID HGNC:15633
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  4. Nakajima T, Ohtani H, Satta Y, Uno Y, Akari H, Ishida T, Kimura A: Natural selection in the TLR-related genes in the course of primate evolution. Immunogenetics. 2008 Dec;60(12):727-35. doi: 10.1007/s00251-008-0332-0. Epub 2008 Sep 23. [PubMed:18810425 ]
  5. Du X, Poltorak A, Wei Y, Beutler B: Three novel mammalian toll-like receptors: gene structure, expression, and evolution. Eur Cytokine Netw. 2000 Sep;11(3):362-71. [PubMed:11022119 ]
  6. Chuang TH, Ulevitch RJ: Cloning and characterization of a sub-family of human toll-like receptors: hTLR7, hTLR8 and hTLR9. Eur Cytokine Netw. 2000 Sep;11(3):372-8. [PubMed:11022120 ]
  7. Hemmi H, Takeuchi O, Kawai T, Kaisho T, Sato S, Sanjo H, Matsumoto M, Hoshino K, Wagner H, Takeda K, Akira S: A Toll-like receptor recognizes bacterial DNA. Nature. 2000 Dec 7;408(6813):740-5. [PubMed:11130078 ]
  8. Takeshita F, Leifer CA, Gursel I, Ishii KJ, Takeshita S, Gursel M, Klinman DM: Cutting edge: Role of Toll-like receptor 9 in CpG DNA-induced activation of human cells. J Immunol. 2001 Oct 1;167(7):3555-8. [PubMed:11564765 ]