You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02895
Secondary Accession Numbers
  • 8403
Name ADAMTS-like protein 1
Synonyms
  1. ADAMTSL-1
  2. Punctin-1
Gene Name ADAMTSL1
Protein Type Enzyme
Biological Properties
General Function Involved in metallopeptidase activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region part
extracellular matrix
proteinaceous extracellular matrix
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
peptidase activity
peptidase activity, acting on l-amino acid peptides
metallopeptidase activity
Cellular Location
  1. Secreted
  2. extracellular space
  3. extracellular matrix
Gene Properties
Chromosome Location Chromosome:9
Locus 9p21.3
SNPs ADAMTSL1
Gene Sequence
>5289 bp
ATGGAATGCTGCCGTCGGGCAACTCCTGGCACACTGCTCCTCTTTCTGGCTTTCCTGCTC
CTGAGTTCCAGGACCGCACGCTCCGAGGAGGACCGGGACGGCCTATGGGATGCCTGGGGC
CCATGGAGTGAATGCTCACGCACCTGCGGGGGTGGGGCCTCCTACTCTCTGAGGCGCTGC
CTGAGCAGCAAGAGCTGTGAAGGAAGAAATATCCGATACAGAACATGCAGTAATGTGGAC
TGCCCACCAGAAGCAGGTGATTTCCGAGCTCAGCAATGCTCAGCTCATAATGATGTCAAG
CACCATGGCCAGTTTTATGAATGGCTTCCTGTGTCTAATGACCCTGACAACCCATGTTCA
CTCAAGTGCCAAGCCAAAGGAACAACCCTGGTTGTTGAACTAGCACCTAAGGTCTTAGAT
GGTACGCGTTGCTATACAGAATCTTTGGATATGTGCATCAGTGGTTTATGCCAAATTGTT
GGCTGCGATCACCAGCTGGGAAGCACCGTCAAGGAAGATAACTGTGGGGTCTGCAACGGA
GATGGGTCCACCTGCCGGCTGGTCCGAGGGCAGTATAAATCCCAGCTCTCCGCAACCAAA
TCGGATGATACTGTGGTTGCAATTCCCTATGGAAGTAGACATATTCGCCTTGTCTTAAAA
GGTCCTGATCACTTATATCTGGAAACCAAAACCCTCCAGGGGACTAAAGGTGAAAACAGT
CTCAGCTCCACAGGAACTTTCCTTGTGGACAATTCTAGTGTGGACTTCCAGAAATTTCCA
GACAAAGAGATACTGAGAATGGCTGGACCACTCACAGCAGATTTCATTGTCAAGATTCGT
AACTCGGGCTCCGCTGACAGTACAGTCCAGTTCATCTTCTATCAACCCATCATCCACCGA
TGGAGGGAGACGGATTTCTTTCCTTGCTCAGCAACCTGTGGAGGAGGTTATCAGCTGACA
TCGGCTGAGTGCTACGATCTGAGGAGCAACCGTGTGGTTGCTGACCAATACTGTCACTAT
TACCCAGAGAACATCAAACCCAAACCCAAGCTTCAGGAGTGCAACTTGGATCCTTGTCCA
GCCAGTGACGGATACAAGCAGATCATGCCTTATGACCTCTACCATCCCCTTCCTCGGTGG
GAGGCCACCCCATGGACCGCGTGCTCCTCCTCGTGTGGGGGGGGCATCCAGAGCCGGGCA
GTTTCCTGTGTGGAGGAGGACATCCAGGGGCATGTCACTTCAGTGGAAGAGTGGAAATGC
ATGTACACCCCTAAGATGCCCATCGCGCAGCCCTGCAACATTTTTGACTGCCCTAAATGG
CTGGCACAGGAGTGGTCTCCGTGCACAGTGACATGTGGCCAGGGCCTCAGATACCGTGTG
GTCCTCTGCATCGACCATCGAGGAATGCACACAGGAGGCTGTAGCCCAAAAACAAAGCCC
CACATAAAAGAGGAATGCATCGTACCCACTCCCTGCTATAAACCCAAAGAGAAACTTCCA
GTCGAGGCCAAGTTGCCATGGTTCAAACAAGCTCAAGAGCTAGAAGAAGGAGCTGCTGTG
TCAGAGGAGCCCTCGTTCATCCCAGAGGCCTGGTCGGCCTGCACAGTCACCTGTGGTGTG
GGGACCCAGGTGCGAATAGTCAGGTGCCAGGTGCTCCTGTCTTTCTCTCAGTCCGTGGCT
GACCTGCCTATTGACGAGTGTGAAGGGCCCAAGCCAGCATCCCAGCGTGCCTGTTATGCA
GGCCCATGCAGCGGGGAAATTCCTGAGTTCAACCCAGACGAGACAGATGGGCTCTTTGGT
GGCCTGCAGGATTTCGACGAGCTGTATGACTGGGAGTATGAGGGGTTCACCAAGTGCTCC
GAGTCCTGTGGAGGAGGTGTCCAGGAGGCTGTGGTGAGCTGCTTGAACAAACAGACTCGG
GAGCCTGCTGAGGAGAACCTGTGCGTGACCAGCCGCCGGCCCCCACAGCTCCTGAAGTCC
TGCAATTTGGATCCCTGCCCAGCAAGGTGGGAAATTGGCAAGTGGAGTCCATGTAGTCTC
ACATGTGGGGTCGGCCTACAGACCAGAGACGTCTTCTGCAGCCACCTGCTTTCCAGAGAG
ATGAATGAAACAGTCATCCTGGCTGATGAGCTGTGTCGCCAGCCCAAGCCCAGCACGGTG
CAAGCTTGTAACCGCTTTAATTGCCCCCCAGCCTGGTACCCTGCACAGTGGCAGCCGTGT
TCCAGAACGTGTGGCGGGGGTGTTCAGAAACGTGAGGTTCTTTGCAAGCAGCGCATGGCT
GATGGCAGCTTCCTGGAGCTTCCTGAGACCTTCTGTTCAGCTTCAAAACCTGCCTGCCAG
CAAGCATGCAAGAAAGATGACTGTCCCAGCGAGTGGCTTCTCTCAGACTGGACAGAGTGT
TCCACAAGCTGCGGGGAAGGCACCCAGACTCGAAGCGCCATTTGCCGAAAGATGCTGAAA
ACCGGCCTCTCAACGGTTGTCAATTCCACCCTGTGCCCGCCCCTGCCTTTCTCTTCCTCC
ATCAGGCCCTGTATGCTGGCAACCTGTGCAAGGCCCGGGCGGCCATCCACGAAGCACAGC
CCGCACATCGCGGCCGCCAGGAAGGTCTACATACAGACTCGCAGGCAGAGGAAGCTGCAC
TTCGTGGTGGGGGGCTTCGCCTACCTGCTCCCCAAGACGGCGGTGGTGCTGCGCTGCCCG
GCGCGCAGGGTCCGCAAGCCCCTCATCACCTGGGAGAAGGACGGCCAGCACCTCATCAGC
TCGACGCACGTCACGGTGGCCCCCTTCGGCTATCTCAAGATCCACCGCCTCAAGCCCTCG
GATGCAGGCGTCTACACCTGCTCAGCGGGCCCGGCCCGGGAGCACTTTGTGATTAAGCTC
ATCGGAGGCAACCGCAAGCTCGTGGCCCGGCCCTTGAGCCCGAGAAGTGAGGAAGAGGTG
CTTGCGGGGAGGAAGGGCGGCCCGAAGGAGGCCCTGCAGACCCACAAACACCAGAACGGG
ATCTTCTCCAACGGCAGCAAGGCGGAGAAGCGGGGCCTGGCCGCCAACCCGGGGAGCCGC
TACGACGACCTCGTCTCCCGGCTGCTGGAGCAGGGCGGCTGGCCCGGAGAGCTGCTGGCC
TCGTGGGAGGCGCAGGACTCTGCGGAAAGGAACACGACCTCGGAGGAGGACCCGGGTGCA
GAGCAAGTGCTCCTGCACCTGCCCTTCACCATGGTGACCGAGCAGCGGCGCCTGGACGAC
ATCCTGGGGAACCTCTCCCAGCAGCCCGAGGAGCTGCGCGACCTCTACAGCAAGCACCTG
GTGGCCCAGCTGGCCCAGGAGATCTTCCGCAGCCACCTGGAGCACCAGGACACGCTCCTG
AAGCCCTCGGAGCGCAGGACTTCCCCAGTGACTCTCTCGCCTCATAAACACGTGTCTGGC
TTCAGCAGCTCCCTGCGGACCTCCTCCACCGGGGACGCCGGGGGAGGCTCTCGAAGGCCA
CACCGCAAGCCCACCATCCTGCGCAAGATCTCAGCGGCCCAGCAGCTCTCAGCCTCGGAG
GTGGTCACCCACCTGGGGCAGACGGTGGCCCTGGCCAGCGGGACACTGAGTGTTCTTCTG
CACTGTGAGGCCATCGGCCACCCAAGGCCTACCATCAGCTGGGCCAGGAATGGAGAAGAA
GTTCAGTTCAGTGACAGGATTCTTCTACAGCCAGATGATTCCTTACAGATCTTGGCACCA
GTGGAAGCAGATGTGGGTTTCTACACTTGCAATGCCACCAATGCCTTGGGATACGACTCT
GTCTCCATTGCCGTCACATTAGCAGGAAAGCCACTAGTGAAAACGTCACGAATGACAGTG
ATCAACACGGAGAAGCCTGCAGTCACAGTCGATATAGGAAGCACCATCAAAACAGTGCAG
GGAGTGAATGTGACAATCAACTGCCAGGTTGCAGGAGTGCCTGAAGCTGAAGTCACTTGG
TTCAGGAATAAAAGCAAACTGGGCTCCCCGCACCATCTGCACGAAGGCTCCTTGCTGCTC
ACAAACGTGTCCTCCTCGGATCAGGGCCTGTACTCCTGCAGGGCGGCCAATCTTCATGGA
GAGCTGACTGAGAGCACCCAGCTGCTGATCCTAGATCCCCCCCAAGTCCCCACACAGTTG
GAAGACATCAGGGCCTTGCTCGCTGCCACTGGACCGAACCTTCCTTCAGTGCTGACGTCT
CCTCTGGGAACACAGCTGGTCCTGGATCCTGGGAATTCTGCTCTCCTTGGCTGCCCCATC
AAAGGTCACCCTGTCCCTAATATCACCTGGTTTCATGGTGGTCAGCCAATTGTCACTGCC
ACAGGACTGACGCATCACATCTTGGCAGCTGGACAGATCCTTCAAGTTGCAAACCTTAGC
GGTGGGTCTCAAGGGGAATTCAGCTGCCTTGCTCAGAATGAGGCAGGGGTGCTCATGCAG
AAGGCATCTTTAGTGATCCAAGATTACTGGTGGTCTGTGGACAGACTGGCAACCTGCTCA
GCCTCCTGTGGTAACCGGGGGGTTCAGCAGCCCCGCTTGAGGTGCCTGCTGAACAGCACG
GAGGTCAACCCTGCCCACTGCGCAGGGAAGGTTCGCCCTGCGGTGCAGCCCATCGCGTGC
AACCGGAGAGACTGCCCTTCTCGGTGGATGGTGACCTCCTGGTCTGCCTGTACCCGGAGC
TGTGGGGGAGGTGTCCAGACCCGCAGGGTGACCTGTCAAAAGCTGAAAGCCTCTGGGATC
TCCACCCCTGTGTCCAATGACATGTGCACCCAGGTCGCCAAGCGGCCTGTGGACACCCAG
GCCTGTAACCAGCAGCTGTGTGTGGAGTGGGCCTTCTCCAGCTGGGGCCAGTGCAATGGG
CCTTGCATCGGGCCTCACCTAGCTGTGCAACACAGACAAGTCTTCTGCCAGACACGGGAT
GGCATCACCTTACCATCAGAGCAGTGCAGTGCTCTTCCGAGGCCTGTGAGCACCCAGAAC
TGCTGGTCAGAGGCCTGCAGTGTACACTGGAGAGTCAGCCTGTGGACCCTGTGCACAGCT
ACCTGTGGCAACTACGGCTTCCAGTCCCGGCGTGTGGAGTGTGTGCATGCCCGCACCAAC
AAGGCAGTGCCTGAGCACCTGTGCTCCTGGGGGCCCCGGCCTGCCAACTGGCAGCGCTGC
AACATCACCCCATGTGAAAACATGGAGTGCAGAGACACCACCAGGTACTGCGAGAAGGTG
AAACAGCTGAAACTCTGCCAACTCAGCCAGTTTAAATCTCGCTGCTGTGGAACTTGTGGC
AAAGCGTGA
Protein Properties
Number of Residues 1762
Molecular Weight 193407.5
Theoretical pI 7.81
Pfam Domain Function
Signals
  • 1-28
Transmembrane Regions
  • None
Protein Sequence
>ADAMTS-like protein 1
MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRC
LSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCS
LKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNG
DGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENS
LSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHR
WRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCP
ASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKC
MYTPKMPIAQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSPKTKP
HIKEECIVPTPCYKPKEKLPVEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVTCGV
GTQVRIVRCQVLLSFSQSVADLPIDECEGPKPASQRACYAGPCSGEIPEFNPDETDGLFG
GLQDFDELYDWEYEGFTKCSESCGGGVQEAVVSCLNKQTREPAEENLCVTSRRPPQLLKS
CNLDPCPARWEIGKWSPCSLTCGVGLQTRDVFCSHLLSREMNETVILADELCRQPKPSTV
QACNRFNCPPAWYPAQWQPCSRTCGGGVQKREVLCKQRMADGSFLELPETFCSASKPACQ
QACKKDDCPSEWLLSDWTECSTSCGEGTQTRSAICRKMLKTGLSTVVNSTLCPPLPFSSS
IRPCMLATCARPGRPSTKHSPHIAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCP
ARRVRKPLITWEKDGQHLISSTHVTVAPFGYLKIHRLKPSDAGVYTCSAGPAREHFVIKL
IGGNRKLVARPLSPRSEEEVLAGRKGGPKEALQTHKHQNGIFSNGSKAEKRGLAANPGSR
YDDLVSRLLEQGGWPGELLASWEAQDSAERNTTSEEDPGAEQVLLHLPFTMVTEQRRLDD
ILGNLSQQPEELRDLYSKHLVAQLAQEIFRSHLEHQDTLLKPSERRTSPVTLSPHKHVSG
FSSSLRTSSTGDAGGGSRRPHRKPTILRKISAAQQLSASEVVTHLGQTVALASGTLSVLL
HCEAIGHPRPTISWARNGEEVQFSDRILLQPDDSLQILAPVEADVGFYTCNATNALGYDS
VSIAVTLAGKPLVKTSRMTVINTEKPAVTVDIGSTIKTVQGVNVTINCQVAGVPEAEVTW
FRNKSKLGSPHHLHEGSLLLTNVSSSDQGLYSCRAANLHGELTESTQLLILDPPQVPTQL
EDIRALLAATGPNLPSVLTSPLGTQLVLDPGNSALLGCPIKGHPVPNITWFHGGQPIVTA
TGLTHHILAAGQILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYWWSVDRLATCS
ASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRS
CGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQQLCVEWAFSSWGQCNG
PCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTA
TCGNYGFQSRRVECVHARTNKAVPEHLCSWGPRPANWQRCNITPCENMECRDTTRYCEKV
KQLKLCQLSQFKSRCCGTCGKA
GenBank ID Protein 154275767
UniProtKB/Swiss-Prot ID Q8N6G6
UniProtKB/Swiss-Prot Entry Name ATL1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001040272.4
GeneCard ID ADAMTSL1
GenAtlas ID ADAMTSL1
HGNC ID HGNC:14632
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  4. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  5. Hirohata S, Wang LW, Miyagi M, Yan L, Seldin MF, Keene DR, Crabb JW, Apte SS: Punctin, a novel ADAMTS-like molecule, ADAMTSL-1, in extracellular matrix. J Biol Chem. 2002 Apr 5;277(14):12182-9. Epub 2002 Jan 22. [PubMed:11805097 ]