You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02900
Secondary Accession Numbers
  • 8408
Name Zinc finger protein 148
Synonyms
  1. Transcription factor ZBP-89
  2. Zinc finger DNA-binding protein 89
Gene Name ZNF148
Protein Type Unknown
Biological Properties
General Function Involved in zinc ion binding
Specific Function Involved in transcriptional regulation. Represses the transcription of a number of genes including gastrin, stromelysin and enolase. Binds to the G-rich box in the enhancer region of these genes
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:3
Locus 3q21
SNPs ZNF148
Gene Sequence
>2385 bp
ATGAACATTGACGACAAACTGGAAGGATTGTTTCTTAAATGTGGCGGCATAGACGAAATG
CAGTCTTCCAGGACAATGGTTGTAATGGGTGGAGTGTCTGGCCAGTCTACTGTGTCTGGA
GAGCTACAGGATTCAGTACTTCAAGATCGAAGTATGCCTCACCAGGAGATCCTTGCTGCA
GATGAAGTGTTACAAGAAAGTGAAATGAGACAACAGGATATGATATCACATGATGAACTC
ATGGTCCATGAGGAGACAGTGAAAAATGATGAAGAGCAGATGGAAACACATGAAAGACTT
CCTCAAGGACTACAGTATGCACTTAATGTCCCTATAAGCGTAAAGCAGGAAATTACTTTT
ACTGATGTATCTGAGCAACTGATGAGAGACAAAAAACAAATCAGAGAGCCAGTAGACTTA
CAGAAAAAGAAGAAGCGGAAACAACGTTCTCCCGCAAAAATCCTTACAATAAATGAGGAT
GGATCACTTGGTTTGAAAACCCCTAAATCTCACGTTTGTGAGCACTGCAATGCTGCCTTT
AGAACGAACTATCACTTACAGAGACATGTCTTCATTCATACAGGTGAAAAACCATTTCAA
TGTAGTCAATGTGACATGCGTTTCATACAGAAGTACCTGCTTCAGAGACATGAGAAGATT
CATACTGGTGAAAAACCATTTCGCTGTGATGAATGTGGTATGAGATTCATACAAAAATAT
CATATGGAAAGGCATAAGAGAACTCATAGTGGAGAAAAACCTTACCAGTGTGAATACTGT
TTACAGTATTTTTCCAGAACAGATCGTGTATTGAAACATAAACGTATGTGCCATGAAAAT
CATGACAAAAAACTAAATAGATGTGCCATCAAAGGTGGCCTTCTGACATCTGAGGAAGAT
TCTGGCTTTTCTACATCACCAAAAGACAACTCACTGCCAAAAAAGAAAAGGCAGAAAACG
GAGAAAAAATCATCTGGAATGGACAAAGAGAGTGCTTTGGACAAATCTGACCTGAAAAAA
GACAAAAATGATTACTTGCCTCTTTATTCTTCAAGTACTAAAGTAAAAGATGAGTATATG
GTTGCAGAATATGCTGTTGAAATGCCACATTCGTCAGTTGGGGGCTCGCATTTAGAAGAT
GCGTCAGGAGAAATACACCCACCTAAGTTAGTTCTCAAAAAAATTAATAGTAAGAGAAGT
CTGAAACAGCCACTGGAGCAAAATCAAACAATTTCACCTTTATCCACATATGAAGAGAGC
AAAGTTTCAAAGTATGCTTTTGAACTTGTGGATAAACAGGCTTTACTGGACTCAGAAGGC
AATGCTGACATTGATCAGGTTGATAATTTGCAGGAGGGGCCCAGTAAACCTGTGCATAGT
AGTACTAATTATGATGATGCCATGCAGTTTTTGAAGAAGAAGCGGTATCTTCAAGCAGCA
AGTAACAACAGCAGGGAATATGCGCTGAATGTGGGTACCATAGCTTCTCAGCCTTCTGTA
ACACAAGCAGCTGTGGCAAGTGTCATTGATGAAAGTACCACGGCATCCATATTAGAGTCA
CAGGCACTGAATGTGGAGATTAAGAGTAATCATGACAAAAATGTTATTCCAGATGAGGTA
CTGCAGACTCTGTTGGATCATTATTCCCACAAAGCTAATGGACAGCATGAGATATCCTTC
AGTGTTGCAGATACTGAAGTGACTTCTAGCATATCAATAAATTCTTCAGAAGTACCAGAG
GTCACCCCGTCAGAGAATGTTGGATCAAGCTCCCAAGCATCCTCATCAGATAAAGCCAAC
ATGTTGCAGGAATACTCCAAGTTTCTGCAGCAGGCTTTGGACAGAACTAGCCAAAATGAT
GCCTATTTGAATAGCCCGAGCCTTAACTTTGTGACTGATAACCAGACCCTCCCAAATCAG
CCAGCATTCTCTTCCATAGACAAGCAGGTCTATGCCACCATGCCCATCAATAGCTTTCGA
TCAGGAATGAATTCTCCACTAAGAACAACTCCAGATAAGTCCCACTTTGGACTAATAGTT
GGTGATTCACAGCACTCATTTCCCTTTTCAGGTGATGAGACAAACCATGCTTCTGCCACA
TCAACACAGGACTTTCTGGATCAAGTGACTTCTCAGAAGAAAGCTGAGGCCCAGCCTGTC
CACCAAGCTTACCAAATGAGCTCCTTTGAACAGCCCTTCCGTGCTCCCTATCATGGATCA
AGAGCTGGAATAGCTACTCAATTTAGCACTGCCAATGGACAGGTGAACCTTCGGGGACCA
GGGACAAGTGCTGAATTTTCAGAATTTCCCTTGGTGAATGTAAATGATAATAGAGCTGGG
ATGACATCTTCACCTGATGCCACAACTGGCCAGACTTTTGGCTAA
Protein Properties
Number of Residues 794
Molecular Weight 88975.6
Theoretical pI 6.46
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger protein 148
MNIDDKLEGLFLKCGGIDEMQSSRTMVVMGGVSGQSTVSGELQDSVLQDRSMPHQEILAA
DEVLQESEMRQQDMISHDELMVHEETVKNDEEQMETHERLPQGLQYALNVPISVKQEITF
TDVSEQLMRDKKQIREPVDLQKKKKRKQRSPAKILTINEDGSLGLKTPKSHVCEHCNAAF
RTNYHLQRHVFIHTGEKPFQCSQCDMRFIQKYLLQRHEKIHTGEKPFRCDECGMRFIQKY
HMERHKRTHSGEKPYQCEYCLQYFSRTDRVLKHKRMCHENHDKKLNRCAIKGGLLTSEED
SGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKSDLKKDKNDYLPLYSSSTKVKDEYM
VAEYAVEMPHSSVGGSHLEDASGEIHPPKLVLKKINSKRSLKQPLEQNQTISPLSTYEES
KVSKYAFELVDKQALLDSEGNADIDQVDNLQEGPSKPVHSSTNYDDAMQFLKKKRYLQAA
SNNSREYALNVGTIASQPSVTQAAVASVIDESTTASILESQALNVEIKSNHDKNVIPDEV
LQTLLDHYSHKANGQHEISFSVADTEVTSSISINSSEVPEVTPSENVGSSSQASSSDKAN
MLQEYSKFLQQALDRTSQNDAYLNSPSLNFVTDNQTLPNQPAFSSIDKQVYATMPINSFR
SGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPV
HQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAG
MTSSPDATTGQTFG
GenBank ID Protein 2828110
UniProtKB/Swiss-Prot ID Q9UQR1
UniProtKB/Swiss-Prot Entry Name ZN148_HUMAN
PDB IDs Not Available
GenBank Gene ID AF039019
GeneCard ID ZNF148
GenAtlas ID ZNF148
HGNC ID HGNC:12933
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  9. Law DJ, Tarle SA, Merchant JL: The human ZBP-89 homolog, located at chromosome 3q21, represses gastrin gene expression. Mamm Genome. 1998 Feb;9(2):165-7. [PubMed:9457682 ]
  10. Ye S, Whatling C, Watkins H, Henney A: Human stromelysin gene promoter activity is modulated by transcription factor ZBP-89. FEBS Lett. 1999 May 7;450(3):268-72. [PubMed:10359087 ]
  11. Boopathi E, Lenka N, Prabu SK, Fang JK, Wilkinson F, Atchison M, Giallongo A, Avadhani NG: Regulation of murine cytochrome c oxidase Vb gene expression during myogenesis: YY-1 and heterogeneous nuclear ribonucleoprotein D-like protein (JKTBP1) reciprocally regulate transcription activity by physical interaction with the BERF-1/ZBP-89 factor. J Biol Chem. 2004 Aug 20;279(34):35242-54. Epub 2004 Jun 9. [PubMed:15190078 ]