You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02916
Secondary Accession Numbers
  • 8424
  • HMDBP03724
Name Solute carrier family 15 member 2
Synonyms
  1. Kidney H(+)/peptide cotransporter
  2. Oligopeptide transporter, kidney isoform
  3. Peptide transporter 2
Gene Name SLC15A2
Protein Type Transporter
Biological Properties
General Function Involved in transporter activity
Specific Function Proton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
peptide transporter activity
oligopeptide transporter activity
transporter activity
substrate-specific transporter activity
Process
peptide transport
oligopeptide transport
establishment of localization
transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:3
Locus 3q13.33
SNPs SLC15A2
Gene Sequence
>2190 bp
ATGAATCCTTTCCAGAAAAATGAGTCCAAGGAAACTCTTTTTTCACCTGTCTCCATTGAA
GAGGTACCACCTCGACCACCTAGCCCTCCAAAGAAGCCATCTCCGACAATCTGTGGCTCC
AACTATCCACTGAGCATTGCCTTCATTGTGGTGAATGAATTCTGCGAGCGCTTTTCCTAT
TATGGAATGAAAGCTGTGCTGATCCTGTATTTCCTGTATTTCCTGCACTGGAATGAAGAT
ACCTCCACATCTATATACCATGCCTTCAGCAGCCTCTGTTATTTTACTCCCATCCTGGGA
GCAGCCATTGCTGACTCGTGGTTGGGAAAATTCAAGACAATCATCTATCTCTCCTTGGTG
TATGTGCTTGGCCATGTGATCAAGTCCTTGGGTGCCTTACCAATACTGGGAGGACAAGTG
GTACACACAGTCCTATCATTGATCGGCCTGAGTCTAATAGCTTTGGGGACAGGAGGCATC
AAACCCTGTGTGGCAGCTTTTGGTGGAGACCAGTTTGAAGAAAAACATGCAGAGGAACGG
ACTAGATACTTCTCAGTCTTCTACCTGTCCATCAATGCAGGGAGCTTGATTTCTACATTT
ATCACACCCATGCTGAGAGGAGATGTGCAATGTTTTGGAGAAGACTGCTATGCATTGGCT
TTTGGAGTTCCAGGACTGCTCATGGTAATTGCACTTGTTGTGTTTGCAATGGGAAGCAAA
ATATACAATAAACCACCCCCTGAAGGAAACATAGTGGCTCAAGTTTTCAAATGTATCTGG
TTTGCTATTTCCAATCGTTTCAAGAACCGTTCTGGAGACATTCCAAAGCGACAGCACTGG
CTAGACTGGGCGGCTGAGAAATATCCAAAGCAGCTCATTATGGATGTAAAGGCACTGACC
AGGGTACTATTCCTTTATATCCCATTGCCCATGTTCTGGGCTCTTTTGGATCAGCAGGGT
TCACGATGGACTTTGCAAGCCATCAGGATGAATAGGAATTTGGGGTTTTTTGTGCTTCAG
CCGGACCAGATGCAGGTTCTAAATCCCCTTCTGGTTCTTATCTTCATCCCGTTGTTTGAC
TTTGTCATTTATCGTCTGGTCTCCAAGTGTGGAATTAACTTCTCATCACTTAGGAAAATG
GCTGTTGGTATGATCCTAGCATGCCTGGCATTTGCAGTTGCGGCAGCTGTAGAGATAAAA
ATAAATGAAATGGCCCCAGCCCAGCCAGGTCCCCAGGAGGTTTTCCTACAAGTCTTGAAT
CTGGCAGATGATGAGGTGAAGGTGACAGTGGTGGGAAATGAAAACAATTCTCTGTTGATA
GAGTCCATCAAATCCTTTCAGAAAACACCACACTATTCCAAACTGCACCTGAAAACAAAA
AGCCAGGATTTTCACTTCCACCTGAAATATCACAATTTGTCTCTCTACACTGAGCATTCT
GTGCAGGAGAAGAACTGGTACAGTCTTGTCATTCGTGAAGATGGGAACAGTATCTCCAGC
ATGATGGTAAAGGATACAGAAAGCAGAACAACCAATGGGATGACAACCGTGAGGTTTGTT
AACACTTTGCATAAAGATGTCAACATCTCCCTGAGTACAGATACCTCTCTCAATGTTGGT
GAAGACTATGGTGTGTCTGCTTATAGAACTGTGCAAAGAGGAGAATACCCTGCAGTGCAC
TGTAGAACAGAAGATAAGAACTTTTCTCTGAATTTGGGTCTTCTAGACTTTGGTGCAGCA
TATCTGTTTGTTATTACTAATAACACCAATCAGGGTCTTCAGGCCTGGAAGATTGAAGAC
ATTCCAGCCAACAAAATGTCCATTGCGTGGCAGCTACCACAATATGCCCTGGTTACAGCT
GGGGAGGTCATGTTCTCTGTCACAGGTCTTGAGTTTTCTTATTCTCAGGCTCCCTCTAGC
ATGAAATCTGTGCTCCAGGCAGCTTGGCTATTGACAATTGCAGTTGGGAATATCATCGTG
CTTGTTGTGGCACAGTTCAGTGGCCTGGTACAGTGGGCCGAATTCATTTTGTTTTCCTGC
CTCCTGCTGGTGATCTGCCTGATCTTCTCCATCATGGGCTACTACTATGTTCCTGTAAAG
ACAGAGGATATGCGGGGTCCAGCAGATAAGCACATTCCTCACATCCAGGGGAACATGATC
AAACTAGAGACCAAGAAGACAAAACTCTGA
Protein Properties
Number of Residues 729
Molecular Weight 81782.8
Theoretical pI 8.27
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 58-78
  • 88-108
  • 115-135
  • 140-160
  • 184-204
  • 218-238
  • 296-316
  • 344-364
  • 381-401
  • 568-588
  • 612-632
  • 644-664
  • 675-695
Protein Sequence
>Solute carrier family 15 member 2
MNPFQKNESKETLFSPVSIEEVPPRPPSPPKKPSPTICGSNYPLSIAFIVVNEFCERFSY
YGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLV
YVLGHVIKSLGALPILGGQVVHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEER
TRYFSVFYLSINAGSLISTFITPMLRGDVQCFGEDCYALAFGVPGLLMVIALVVFAMGSK
IYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALT
RVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLGFFVLQPDQMQVLNPLLVLIFIPLFD
FVIYRLVSKCGINFSSLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLN
LADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHS
VQEKNWYSLVIREDGNSISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVG
EDYGVSAYRTVQRGEYPAVHCRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIED
IPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIV
LVVAQFSGLVQWAEFILFSCLLLVICLIFSIMGYYYVPVKTEDMRGPADKHIPHIQGNMI
KLETKKTKL
GenBank ID Protein 158260663
UniProtKB/Swiss-Prot ID Q16348
UniProtKB/Swiss-Prot Entry Name S15A2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK289820
GeneCard ID SLC15A2
GenAtlas ID SLC15A2
HGNC ID HGNC:10921
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Liu W, Liang R, Ramamoorthy S, Fei YJ, Ganapathy ME, Hediger MA, Ganapathy V, Leibach FH: Molecular cloning of PEPT 2, a new member of the H+/peptide cotransporter family, from human kidney. Biochim Biophys Acta. 1995 May 4;1235(2):461-6. [PubMed:7756356 ]