You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02975
Secondary Accession Numbers
  • 8492
Name UDP-N-acetylglucosamine transporter
Synonyms
  1. Golgi UDP-GlcNAc transporter
  2. Solute carrier family 35 member A3
Gene Name SLC35A3
Protein Type Enzyme
Biological Properties
General Function Involved in sugar:hydrogen symporter activity
Specific Function Uridine diphosphate-N-acetylglucosamine transporter in the Golgi apparatus.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
UDP-N-acetylglucosamine metabolic process
Cellular Component
integral to membrane
Golgi membrane
Component
golgi membrane
membrane
cell part
membrane part
organelle membrane
intrinsic to membrane
integral to membrane
Function
carbohydrate transmembrane transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
nucleotide-sugar transmembrane transporter activity
solute:cation symporter activity
cation:sugar symporter activity
sugar:hydrogen symporter activity
transporter activity
Molecular Function
UDP-N-acetylglucosamine transmembrane transporter activity
sugar:hydrogen symporter activity
Process
establishment of localization
transport
carbohydrate transport
nucleotide-sugar transport
Cellular Location
  1. Golgi apparatus membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 1
Locus 1p21
SNPs SLC35A3
Gene Sequence
>978 bp
ATGTTCGCCAACCTAAAATACGTTTCCCTGGGAATTTTGGTCTTTCAGACTACCAGTTTG
GTTCTAACAATGCGTTATTCCAGAACTTTAAAAGAAGAAGGACCTCGTTATCTATCTTCT
ACAGCAGTGGTTGTTGCTGAACTTTTGAAGATAATGGCCTGCATTTTATTGGTCTACAAA
GACAGCAAATGTAGTCTAAGAGCACTGAATCGAGTACTACATGATGAAATTCTTAATAAA
CCTATGGAAACACTTAAACTTGCTATTCCATCAGGGATCTATACTCTTCAGAATAATTTA
CTGTATGTGGCACTATCAAATCTAGATGCAGCTACTTATCAGGTCACGTATCAGTTAAAA
ATTCTTACAACAGCATTATTTTCTGTGTCTATGCTTAGTAAAAAATTGGGTGTATACCAG
TGGCTGTCCCTAGTAATTTTGATGACAGGAGTTGCTTTTGTACAGTGGCCCTCAGATTCT
CAGCTTGATTCTAAGGAACTTTCAGCTGGTTCTCAATTTGTAGGACTCATGGCAGTTCTC
ACAGCATGTTTTTCAAGTGGCTTTGCTGGGGTTTACTTTGAGAAAATCTTAAAAGAAACA
AAACAATCAGTGTGGATAAGAAATATTCAGCTTGGTTTCTTTGGAAGTATATTTGGATTA
ATGGGTGTATACATTTATGATGGAGAACTGGTATCAAAGAATGGATTTTTTCAGGGATAT
AACCGACTGACCTGGATAGTAGTTGTTCTTCAGGCACTTGGAGGCCTTGTAATAGCTGCT
GTTATTAAGTATGCAGATAATATTTTAAAAGGATTTGCAACCTCTTTATCGATAATATTA
TCAACATTGATCTCCTATTTTTGGCTTCAAGATTTTGTGCCAACCAGTGTCTTTTTCCTT
GGAGCCATCCTTGTAATAACAGCTACTTTTTTGTATGGTTATGATCCCAAACCTGCAGGA
AATCCCACTAAAGCATAG
Protein Properties
Number of Residues 325
Molecular Weight 40684.46
Theoretical pI 8.903
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>UDP-N-acetylglucosamine transporter
MFANLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYK
DSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLK
ILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVL
TACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGY
NRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFL
GAILVITATFLYGYDPKPAGNPTKA
GenBank ID Protein 4903004
UniProtKB/Swiss-Prot ID Q9Y2D2
UniProtKB/Swiss-Prot Entry Name S35A3_HUMAN
PDB IDs Not Available
GenBank Gene ID AB021981
GeneCard ID SLC35A3
GenAtlas ID SLC35A3
HGNC ID HGNC:11023
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Ishida N, Yoshioka S, Chiba Y, Takeuchi M, Kawakita M: Molecular cloning and functional expression of the human Golgi UDP-N-acetylglucosamine transporter. J Biochem. 1999 Jul;126(1):68-77. [PubMed:10393322 ]