Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02976
Secondary Accession Numbers
  • 8494
Name Sodium-dependent phosphate transporter 2
Synonyms
  1. GLVR-2
  2. Gibbon ape leukemia virus receptor 2
  3. Phosphate transporter 2
  4. PiT-2
  5. Pit2
  6. Solute carrier family 20 member 2
  7. hPit2
Gene Name SLC20A2
Protein Type Unknown
Biological Properties
General Function Involved in inorganic phosphate transmembrane transporter activity
Specific Function Sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. May play a role in extracellular matrix, cartilage and vascular calcification. Functions as a retroviral receptor and confers human cells susceptibility to infection to amphotropic murine leukemia virus (A-MuLV), 10A1 murine leukemia virus (10A1 MLV) and some feline leukemia virus subgroup B (FeLV-B) variants.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
virus-host interaction
Cellular Component
integral to plasma membrane
Component
membrane
cell part
Function
inorganic anion transmembrane transporter activity
phosphate transmembrane transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
inorganic phosphate transmembrane transporter activity
transporter activity
anion transmembrane transporter activity
Molecular Function
inorganic phosphate transmembrane transporter activity
receptor activity
sodium:phosphate symporter activity
Process
establishment of localization
transport
phosphate transport
anion transport
inorganic anion transport
ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 8
Locus 8p11.21
SNPs SLC20A2
Gene Sequence
>1959 bp
ATGGCCATGGATGAGTATTTGTGGATGGTCATTTTGGGTTTCATCATAGCTTTCATCTTG
GCCTTTTCTGTTGGTGCAAACGATGTTGCCAACTCCTTTGGTACAGCCGTGGGCTCTGGT
GTGGTGACCTTGAGGCAGGCATGCATTTTAGCTTCAATATTTGAAACCACCGGCTCCGTG
TTACTAGGCGCCAAAGTAGGAGAAACCATTCGCAAAGGTATCATTGACGTGAACCTGTAC
AACGAGACGGTGGAGACTCTCATGGCTGGGGAAGTTAGTGCCATGGTTGGTTCCGCTGTG
TGGCAGCTGATTGCTTCCTTCCTGAGGCTTCCAATCTCAGGAACGCACTGCATTGTGGGT
TCTACTATAGGATTCTCACTGGTCGCAATCGGTACCAAAGGTGTGCAGTGGATGGAGCTT
GTCAAGATTGTTGCTTCTTGGTTTATATCTCCACTGTTGTCTGGTTTCATGTCTGGCCTG
CTGTTTGTACTCATCAGAATTTTCATCTTAAAAAAGGAAGACCCTGTTCCCAATGGCCTC
CGGGCACTCCCAGTATTCTATGCTGCTACCATAGCAATCAATGTCTTTTCCATCATGTAC
ACAGGAGCACCAGTGCTCGGCCTTGTTCTCCCCATGTGGGCCATAGCCCTCATTTCCTTT
GGTGTCGCCCTCCTGTTCGCTTTTTTTGTGTGGCTCTTCGTGTGTCCGTGGATGCGGAGG
AAAATAACAGGCAAATTACAAAAAGAAGGTGCTTTATCACGAGTATCTGACGAAAGCCTC
AGTAAGGTTCAGGAAGCAGAGTCCCCAGTATTTAAAGAGCTACCAGGTGCCAAGGCTAAT
GATGACAGCACCATCCCGCTCACGGGAGCAGCAGGGGAGACACTGGGGACCTCGGAAGGC
ACTTCTGCGGGCAGCCACCCTCGGGCTGCATACGGAAGAGCACTGTCCATGACCCATGGC
TCTGTGAAATCGCCCATCTCCAACGGCACCTTCGGCTTCGACGGCCACACCAGGAGCGAC
GGTCATGTGTACCACACCGTGCACAAAGACTCGGGGCTCTACAAAGATCTGCTGCACAAA
ATCCACATCGACAGGGGCCCCGAGGAGAAGCCAGCCCAGGAAAGCAACTACCGGCTGCTG
CGCCGAAACAACAGTTACACCTGCTACACCGCAGCCATTTGTGGGCTGCCAGTGCACGCC
ACCTTTCGAGCTGCGGACTCATCGGCCCCAGAGGACAGTGAGAAGCTGGTGGGCGACACC
GTGTCCTACTCCAAGAAGAGGCTGCGCTACGACAGCTACTCGAGCTACTGTAACGCGGTG
GCAGAGGCGGAGATCGAGGCGGAGGAGGGCGGCGTGGAGATGAAGCTGGCGTCGGAGCTG
GCCGACCCTGACCAGCCGCGAGAGGACCCTGCAGAGGAGGAGAAGGAGGAGAAGGACGCA
CCCGAGGTTCACCTCCTGTTCCATTTCCTGCAGGTCCTCACCGCCTGTTTCGGGTCCTTT
GCTCACGGCGGCAATGACGTGAGTAATGCCATCGGTCCCCTGGTAGCCTTGTGGCTGATT
TACAAACAAGGCGGGGTAACGCAAGAAGCAGCTACACCCGTCTGGCTGCTGTTTTATGGA
GGAGTTGGAATCTGCACAGGCCTCTGGGTCTGGGGGAGAAGAGTGATCCAGACCATGGGG
AAGGACCTCACTCCCATCACGCCGTCCAGCGGCTTCACGATCGAGCTGGCCTCAGCCTTC
ACAGTGGTGATCGCCTCCAACATCGGGCTTCCAGTCAGCACCACGCACTGTAAGGTGGGC
TCGGTGGTGGCCGTGGGCTGGATCCGCTCCCGCAAGGCTGTGGACTGGCGCCTCTTTCGG
AACATCTTCGTGGCCTGGTTCGTGACCGTCCCTGTGGCTGGGCTGTTCAGCGCTGCTGTC
ATGGCTCTTCTCATGTATGGGATCCTTCCATATGTGTGA
Protein Properties
Number of Residues 652
Molecular Weight 70391.755
Theoretical pI 6.535
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium-dependent phosphate transporter 2
MAMDEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSV
LLGAKVGETIRKGIIDVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVG
STIGFSLVAIGTKGVQWMELVKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGL
RALPVFYAATIAINVFSIMYTGAPVLGLVLPMWAIALISFGVALLFAFFVWLFVCPWMRR
KITGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEG
TSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGHVYHTVHKDSGLYKDLLHK
IHIDRGPEEKPAQESNYRLLRRNNSYTCYTAAICGLPVHATFRAADSSAPEDSEKLVGDT
VSYSKKRLRYDSYSSYCNAVAEAEIEAEEGGVEMKLASELADPDQPREDPAEEEKEEKDA
PEVHLLFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYG
GVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVG
SVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALLMYGILPYV
GenBank ID Protein 158255840
UniProtKB/Swiss-Prot ID Q08357
UniProtKB/Swiss-Prot Entry Name S20A2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK291202
GeneCard ID SLC20A2
GenAtlas ID SLC20A2
HGNC ID HGNC:10947
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. van Zeijl M, Johann SV, Closs E, Cunningham J, Eddy R, Shows TB, O'Hara B: A human amphotropic retrovirus receptor is a second member of the gibbon ape leukemia virus receptor family. Proc Natl Acad Sci U S A. 1994 Feb 1;91(3):1168-72. [PubMed:8302848 ]
  6. Salaun C, Rodrigues P, Heard JM: Transmembrane topology of PiT-2, a phosphate transporter-retrovirus receptor. J Virol. 2001 Jun;75(12):5584-92. [PubMed:11356966 ]
  7. Chien ML, Foster JL, Douglas JL, Garcia JV: The amphotropic murine leukemia virus receptor gene encodes a 71-kilodalton protein that is induced by phosphate depletion. J Virol. 1997 Jun;71(6):4564-70. [PubMed:9151850 ]
  8. Sugai J, Eiden M, Anderson MM, Van Hoeven N, Meiering CD, Overbaugh J: Identification of envelope determinants of feline leukemia virus subgroup B that permit infection and gene transfer to cells expressing human Pit1 or Pit2. J Virol. 2001 Aug;75(15):6841-9. [PubMed:11435563 ]
  9. Bottger P, Pedersen L: Two highly conserved glutamate residues critical for type III sodium-dependent phosphate transport revealed by uncoupling transport function from retroviral receptor function. J Biol Chem. 2002 Nov 8;277(45):42741-7. Epub 2002 Aug 29. [PubMed:12205090 ]
  10. Bottger P, Pedersen L: Evolutionary and experimental analyses of inorganic phosphate transporter PiT family reveals two related signature sequences harboring highly conserved aspartic acids critical for sodium-dependent phosphate transport function of human PiT2. FEBS J. 2005 Jun;272(12):3060-74. [PubMed:15955065 ]
  11. Bottger P, Hede SE, Grunnet M, Hoyer B, Klaerke DA, Pedersen L: Characterization of transport mechanisms and determinants critical for Na+-dependent Pi symport of the PiT family paralogs human PiT1 and PiT2. Am J Physiol Cell Physiol. 2006 Dec;291(6):C1377-87. Epub 2006 Jun 21. [PubMed:16790504 ]