You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03037
Secondary Accession Numbers
  • 8563
  • HMDBP06409
Name Proline synthase co-transcribed bacterial homolog protein
Synonyms Not Available
Gene Name PROSC
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:8
Locus 8p11.2
SNPs PROSC
Gene Sequence
>828 bp
ATGTGGAGAGCTGGCAGCATGTCGGCCGAGCTGGGAGTCGGGTGCGCATTGCGGGCGGTG
AACGAGCGCGTGCAGCAGGCTGTGGCGCGGCGGCCGCGGGATCTCCCAGCCATCCAGCCC
CGGCTAGTGGCGGTCAGCAAAACCAAACCTGCAGACATGGTGATCGAGGCCTATGGACAT
GGGCAGCGCACTTTTGGCGAGAACTACGTTCAGGAACTGCTAGAAAAAGCATCAAATCCC
AAAATTCTGTCTTTGTGTCCTGAGATCAAATGGCACTTCATTGGCCACCTACAGAAACAA
AATGTCAACAAATTGATGGCTGTCCCCAATCTCTTCATGCTGGAAACAGTGGATTCTGTG
AAGTTGGCAGACAAAGTGAACAGTTCCTGGCAGAGAAAAGGTTCTCCTGAAAGGTTAAAG
GTTATGGTCCAGATTAACACCAGCGGAGAAGAGAGTAAACATGGCCTTCCACCTTCAGAG
ACCATAGCCATCGTGGAGCACATAAACGCCAAGTGTCCTAACCTGGAGTTTGTGGGGCTG
ATGACCATAGGAAGCTTTGGGCATGATCTTAGTCAAGGACCAAATCCAGACTTCCAGCTG
TTATTGTCCCTCCGGGAGGAGCTGTGTAAAAAGCTGAACATCCCTGCTGACCAGGTTGAG
CTGAGCATGGGCATGTCCGCGGATTTCCAGCATGCGGTTGAAGTAGGATCTACAAATGTC
CGAATAGGAAGCACGATTTTTGGAGAGCGGGATTACTCAAAGAAACCCACCCCGGACAAG
TGCGCAGCAGACGTGAAGGCCCCGCTGGAGGTGGCACAGGAGCACTGA
Protein Properties
Number of Residues 275
Molecular Weight 30343.7
Theoretical pI 7.57
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Proline synthase co-transcribed bacterial homolog protein
MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGH
GQRTFGENYVQELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSV
KLADKVNSSWQRKGSPERLKVMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGL
MTIGSFGHDLSQGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSADFQHAVEVGSTNV
RIGSTIFGERDYSKKPTPDKCAADVKAPLEVAQEH
GenBank ID Protein 4126978
UniProtKB/Swiss-Prot ID O94903
UniProtKB/Swiss-Prot Entry Name PROSC_HUMAN
PDB IDs Not Available
GenBank Gene ID AB018566
GeneCard ID PROSC
GenAtlas ID PROSC
HGNC ID HGNC:9457
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  4. Ikegawa S, Isomura M, Koshizuka Y, Nakamura Y: Cloning and characterization of human and mouse PROSC (proline synthetase co-transcribed) genes. J Hum Genet. 1999;44(5):337-42. [PubMed:10496079 ]