You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03038
Secondary Accession Numbers
  • 8564
Name Acetyl-coenzyme A transporter 1
Synonyms
  1. AT-1
  2. Acetyl-CoA transporter 1
  3. Solute carrier family 33 member 1
Gene Name SLC33A1
Protein Type Enzyme
Biological Properties
General Function Carbohydrate transport and metabolism
Specific Function Probable acetyl-CoA transporter necessary for O-acetylation of gangliosides.
Pathways
  • Glycosphingolipid biosynthesis - ganglio series
Reactions Not Available
GO Classification
Biological Process
cell death
transmembrane transport
Cellular Component
endoplasmic reticulum membrane
Golgi membrane
integral to plasma membrane
Component
membrane
cell part
Molecular Function
acetyl-CoA transporter activity
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein (Probable)
Gene Properties
Chromosome Location 3
Locus 3q25.31
SNPs SLC33A1
Gene Sequence
>1650 bp
ATGTCACCCACCATCTCCCACAAGGACAGCAGCCGGCAACGGCGGCCAGGGAATTTCAGT
CACTCTCTGGATATGAAGAGCGGTCCCCTGCCGCCAGGCGGTTGGGATGACAGTCATTTG
GACTCAGCGGGCCGGGAAGGGGACAGAGAAGCTCTTCTGGGGGATACCGGCACTGGCGAC
TTCTTAAAAGCCCCACAGAGCTTCCGGGCCGAACTAAGCAGCATTTTGCTACTACTCTTT
CTTTACGTGCTTCAGGGTATTCCCCTGGGCTTGGCGGGAAGCATCCCACTCATTTTGCAA
AGCAAAAATGTTAGCTATACAGACCAAGCTTTCTTCAGTTTTGTCTTTTGGCCCTTCAGT
CTCAAATTACTCTGGGCCCCGTTGGTTGATGCGGTCTACGTTAAGAACTTCGGTCGTCGC
AAATCTTGGCTTGTCCCGACACAGTATATACTAGGACTCTTCATGATCTATTTATCCACT
CAGGTGGACCGTTTGCTTGGGAATACCGATGACAGAACACCCGACGTGATTGCTCTCACT
GTGGCGTTCTTTTTGTTTGAATTCTTGGCCGCCACTCAGGACATTGCCGTCGATGGTTGG
GCGTTAACTATGTTATCCAGGGAAAATGTGGGTTATGCTTCTACTTGCAATTCGGTGGGC
CAAACAGCGGGTTACTTTTTGGGCAATGTTTTGTTTTTGGCCCTTGAATCTGCCGACTTT
TGTAACAAATATTTGCGGTTTCAGCCTCAACCCAGAGGAATCGTTACTCTTTCAGATTTC
CTTTTTTTCTGGGGAACTGTATTTTTAATAACAACAACATTGGTTGCCCTTCTGAAAAAA
GAAAACGAAGTATCAGTAGTAAAAGAAGAAACACAAGGGATCACAGATACTTACAAGCTG
CTTTTTGCAATTATAAAAATGCCAGCAGTTCTGACATTTTGCCTTCTGATTCTAACTGCA
AAGATTGGTTTTTCAGCAGCAGATGCTGTAACAGGACTGAAATTGGTAGAAGAGGGAGTA
CCCAAAGAACATTTAGCCTTATTGGCAGTTCCAATGGTTCCTTTGCAGATAATACTGCCT
CTGATTATCAGCAAATACACTGCAGGTCCCCAGCCATTAAACACATTTTACAAAGCCATG
CCCTACAGATTATTGCTTGGGTTAGAATATGCCCTACTGGTTTGGTGGACTCCTAAAGTA
GAACATCAAGGGGGATTCCCTATATATTACTATATCGTAGTCCTGCTGAGTTATGCTTTA
CATCAGGTTACAGTGTACAGCATGTATGTTTCTATAATGGCTTTCAATGCAAAGGTTAGT
GATCCACTTATTGGAGGAACATACATGACCCTTTTAAATACCGTGTCCAATCTGGGAGGA
AACTGGCCTTCTACAGTAGCTCTTTGGCTTGTAGATCCCCTCACAGTAAAAGAGTGTGTA
GGAGCATCAAACCAGAATTGTCGAACACCTGATGCTGTTGAGCTTTGCAAAAAACTGGGT
GGCTCATGTGTTACAGCCCTGGATGGTTATTATGTGGAGTCCATTATTTGTGTTTTCATT
GGATTTGGTTGGTGGTTCTTTCTTGGTCCAAAATTTAAAAAGTTACAGGATGAAGGATCA
TCTTCGTGGAAATGCAAAAGGAACAATTAA
Protein Properties
Number of Residues 549
Molecular Weight 60908.39
Theoretical pI 7.322
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Acetyl-coenzyme A transporter 1
MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGD
FLKAPQSFRAELSSILLLLFLYVLQGIPLGLAGSIPLILQSKNVSYTDQAFFSFVFWPFS
LKLLWAPLVDAVYVKNFGRRKSWLVPTQYILGLFMIYLSTQVDRLLGNTDDRTPDVIALT
VAFFLFEFLAATQDIAVDGWALTMLSRENVGYASTCNSVGQTAGYFLGNVLFLALESADF
CNKYLRFQPQPRGIVTLSDFLFFWGTVFLITTTLVALLKKENEVSVVKEETQGITDTYKL
LFAIIKMPAVLTFCLLILTAKIGFSAADAVTGLKLVEEGVPKEHLALLAVPMVPLQIILP
LIISKYTAGPQPLNTFYKAMPYRLLLGLEYALLVWWTPKVEHQGGFPIYYYIVVLLSYAL
HQVTVYSMYVSIMAFNAKVSDPLIGGTYMTLLNTVSNLGGNWPSTVALWLVDPLTVKECV
GASNQNCRTPDAVELCKKLGGSCVTALDGYYVESIICVFIGFGWWFFLGPKFKKLQDEGS
SSWKCKRNN
GenBank ID Protein 189053393
UniProtKB/Swiss-Prot ID O00400
UniProtKB/Swiss-Prot Entry Name ACATN_HUMAN
PDB IDs Not Available
GenBank Gene ID AK312268
GeneCard ID SLC33A1
GenAtlas ID SLC33A1
HGNC ID HGNC:95
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  5. Kanamori A, Nakayama J, Fukuda MN, Stallcup WB, Sasaki K, Fukuda M, Hirabayashi Y: Expression cloning and characterization of a cDNA encoding a novel membrane protein required for the formation of O-acetylated ganglioside: a putative acetyl-CoA transporter. Proc Natl Acad Sci U S A. 1997 Apr 1;94(7):2897-902. [PubMed:9096318 ]
  6. Lin P, Li J, Liu Q, Mao F, Li J, Qiu R, Hu H, Song Y, Yang Y, Gao G, Yan C, Yang W, Shao C, Gong Y: A missense mutation in SLC33A1, which encodes the acetyl-CoA transporter, causes autosomal-dominant spastic paraplegia (SPG42). Am J Hum Genet. 2008 Dec;83(6):752-9. doi: 10.1016/j.ajhg.2008.11.003. [PubMed:19061983 ]