You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03054
Secondary Accession Numbers
  • 8586
Name Sodium/potassium/calcium exchanger 4
Synonyms
  1. Na(+)/K(+)/Ca(2+)-exchange protein 4
  2. Solute carrier family 24 member 4
Gene Name SLC24A4
Protein Type Unknown
Biological Properties
General Function Involved in transmembrane transport
Specific Function Transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+)
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 14q32.12
SNPs SLC24A4
Gene Sequence
>1818 bp
ATGCTGCCGCAGCAAGTCGGCTTCGTGTGCGCGGTGCTGGCCCTGGTGTGCTGTGCGTCC
GGCCTCTTCGGCAGCTTGGGGCACAAAACAGCTTCTGCTAGCAAACGTGTCCTGCCAGAC
ACATGGAGAAATAGAAAGTTGATGGCCCCAGTGAATGGGACACAGACAGCCAAGAACTGC
ACAGATCCTGCGATTCACGAGTTCCCCACAGATCTGTTCTCCAATAAGGAGCGACAGCAC
GGAGCCGTCCTGCTGCACATCCTTGGTGCTCTGTATATGTTCTATGCCTTGGCCATAGTG
TGCGATGACTTCTTTGTTCCGTCTCTAGAGAAGATCTGTGAGAGACTCCATCTGAGCGAA
GATGTGGCTGGAGCCACCTTCATGGCTGCAGGAAGCTCAACGCCAGAGCTGTTTGCGTCT
GTTATTGGGGTGTTCATCACCCATGGGGACGTCGGGGTGGGCACCATCGTGGGCTCTGCT
GTGTTCAACATCCTGTGCATAATTGGAGTGTGCGGACTGTTTGCTGGCCAGGTGGTCCGT
CTGACGTGGTGGGCCGTGTGCCGAGACTCCGTGTACTACACCATCTCTGTCATCGTGCTC
ATCGTGTTCATATATGATGAACAAATTGTGTGGTGGGAAGGCCTGGTGCTCATCATCTTG
TATGTGTTTTATATTCTGATCATGAAGTACAATGTGAAGATGCAAGCCTTTTTCACAGTC
AAACAAAAGAGCATTGCAAACGGTAACCCGGTCAACAGTGAGCTGGAGGCTGGTAATGAT
TTCTATGACGGTAGCTATGATGACCCTTCCGTGCCATTGCTGGGGCAAGTGAAGGAGAAG
CCACAGTATGGCAAGAACCCCGTGGTGATGGTGGACGAGATTATGAGCTCCAGCCCTCCC
AAGTTCACCTTCCCTGAAGCAGGCTTACGAATCATGATCACCAATAAGTTTGGACCCAGG
ACCCGACTACGGATGGCCAGCAGGATCATCATTAATGAGCGGCAGAGACTGATCAACTCG
GCCAATGGTGTGAGCAGTAAGCCGCTTCAAAACGGGAGGCACGAGAACATTGAGAACGGG
AATGTTCCTGTGGAAAACCCCGAAGACCCTCAGCAGAATCAGGAGCAGCAGCCGCCGCCA
CAGCCACCACCGCCAGAGCCAGAGCCGGTGGAGGCTGACTTCCTGTCCCCCTTCTCCGTG
CCGGAGGCCAGAGGGGACAAGGTCAAGTGGGTGTTCACCTGGCCCCTCATCTTCCTCCTG
TGCGTCACCATTCCCAACTGCAGCAAGCCCCGCTGGGAGAAGTTCTTCATGGTCACCTTC
ATCACCGCCACGCTGTGGATCGCTGTGTTCTCCTACATCATGGTGTGGCTGGTGACTATT
ATCGGATACACACTTGGGATCCCGGATGTCATCATGGGCATTACTTTCCTGGCAGCAGGG
ACAAGTGTTCCAGACTGCATGGCCAGCCTAATTGTGGCGAGACAAGGCCTTGGGGACATG
GCAGTCTCCAACACCATAGGAAGCAACGTGTTTGACATCCTGGTAGGACTTGGTGTACCG
TGGGGCCTGCAGACCATGGTTGTTAATTATGGATCAACAGTGAAGATCAACAGCCGGGGG
CTGGTCTATTCCGTGGTCCTGTTGCTGGGCTCTGTCGCTCTCACCGTCCTCGGCATCCAC
CTAAACAAGTGGCGACTGGACCGGAAGCTGGGTGTCTACGTGCTGGTTCTCTACGCCATC
TTCTTGTGCTTCTCCATAATGATAGAGTTTAACGTCTTTACCTTCGTCAACTTGCCGATG
TGCCGGGAAGACGATTAG
Protein Properties
Number of Residues 605
Molecular Weight 66950.8
Theoretical pI 6.31
Pfam Domain Function
Signals
  • 1-21
Transmembrane Regions
  • 81-101
  • 156-176
  • 184-204
  • 208-228
  • 408-428
  • 441-461
  • 463-483
  • 510-530
  • 541-561
  • 570-590
Protein Sequence
>Sodium/potassium/calcium exchanger 4
MLPQQVGFVCAVLALVCCASGLFGSLGHKTASASKRVLPDTWRNRKLMAPVNGTQTAKNC
TDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDDFFVPSLEKICERLHLSE
DVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVR
LTWWAVCRDSVYYTISVIVLIVFIYDEQIVWWEGLVLIILYVFYILIMKYNVKMQAFFTV
KQKSIANGNPVNSELEAGNDFYDGSYDDPSVPLLGQVKEKPQYGKNPVVMVDEIMSSSPP
KFTFPEAGLRIMITNKFGPRTRLRMASRIIINERQRLINSANGVSSKPLQNGRHENIENG
NVPVENPEDPQQNQEQQPPPQPPPPEPEPVEADFLSPFSVPEARGDKVKWVFTWPLIFLL
CVTIPNCSKPRWEKFFMVTFITATLWIAVFSYIMVWLVTIIGYTLGIPDVIMGITFLAAG
TSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGLQTMVVNYGSTVKINSRG
LVYSVVLLLGSVALTVLGIHLNKWRLDRKLGVYVLVLYAIFLCFSIMIEFNVFTFVNLPM
CREDD
GenBank ID Protein 21702721
UniProtKB/Swiss-Prot ID Q8NFF2
UniProtKB/Swiss-Prot Entry Name NCKX4_HUMAN
PDB IDs Not Available
GenBank Gene ID AF520704
GeneCard ID SLC24A4
GenAtlas ID SLC24A4
HGNC ID HGNC:10978
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  5. Sulem P, Gudbjartsson DF, Stacey SN, Helgason A, Rafnar T, Magnusson KP, Manolescu A, Karason A, Palsson A, Thorleifsson G, Jakobsdottir M, Steinberg S, Palsson S, Jonasson F, Sigurgeirsson B, Thorisdottir K, Ragnarsson R, Benediktsdottir KR, Aben KK, Kiemeney LA, Olafsson JH, Gulcher J, Kong A, Thorsteinsdottir U, Stefansson K: Genetic determinants of hair, eye and skin pigmentation in Europeans. Nat Genet. 2007 Dec;39(12):1443-52. Epub 2007 Oct 21. [PubMed:17952075 ]
  6. Li XF, Kraev AS, Lytton J: Molecular cloning of a fourth member of the potassium-dependent sodium-calcium exchanger gene family, NCKX4. J Biol Chem. 2002 Dec 13;277(50):48410-7. Epub 2002 Oct 11. [PubMed:12379639 ]