You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03061
Secondary Accession Numbers
  • 8593
Name Cytosolic beta-glucosidase
Synonyms
  1. Cytosolic beta-glucosidase-like protein 1
Gene Name GBA3
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity, hydrolyzing O-glycosyl compounds
Specific Function Glycosidase probably involved in the intestinal absorption and metabolism of dietary flavonoid glycosides. Able to hydrolyze a broad variety of glycosides including phytoestrogens, flavonols, flavones, flavanones and cyanogens. Possesses beta-glycosylceramidase activity and may be involved in a nonlysosomal catabolic pathway of glycosylceramide.
Pathways
  • Cyanoamino acid metabolism
  • Starch and sucrose metabolism
Reactions
Cellobiose + Water → Beta-D-Glucose details
Prunasin + Water → Mandelonitrile + D-Glucose details
Cellulose + Water → Cellulose + Beta-D-Glucose details
Prunasin + D-Glucose → Amygdalin + Water details
D-Glucoside + Water → ROH + Alpha-D-Glucose details
Cyanoglycoside + Water → Cyanohydrin + D-Glucose details
cis-beta-D-Glucosyl-2-hydroxycinnamate + Water → Coumaric acid + D-Glucose details
Dhurrin + Water → (S)-4-Hydroxymandelonitrile + Beta-D-Glucose details
Lotaustralin + Water → (2R)-2-Hydroxy-2-methylbutanenitrile + Beta-D-Glucose details
Linamarin + Water → Acetone cyanohydrin + Beta-D-Glucose details
Malvidin 3-galactoside → 3,5,7-trihydroxy-2-(4-hydroxy-3,5-dimethoxyphenyl)-1λ⁴-chromen-1-ylium details
11-hydroxy-7-(4-hydroxy-3,5-dimethoxyphenyl)-3-(4-hydroxyphenyl)-6-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-2λ⁴,8-dioxatricyclo[7.3.1.0⁵,¹³]trideca-1(13),2,4,6,9,11-hexaen-2-ylium → Pigment A aglycone details
GO Classification
Biological Process
small molecule metabolic process
phospholipid metabolic process
glycoside catabolic process
glycosylceramide catabolic process
carbohydrate metabolic process
Cellular Component
cytosol
Function
ion binding
cation binding
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing o-glycosyl compounds
Molecular Function
beta-galactosidase activity
cation binding
beta-glucosidase activity
glycosylceramidase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location
  1. Cytoplasm
  2. cytosol
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs GBA3
Gene Sequence
>1410 bp
ATGGCTTTCCCTGCAGGATTTGGATGGGCGGCAGCCACTGCAGCTTATCAAGTAGAAGGA
GGCTGGGATGCAGATGGAAAAGGCCCTTGTGTCTGGGACACATTTACTCATCAGGGAGGA
GAGAGAGTTTTCAAGAACCAGACTGGCGATGTAGCTTGTGGCAGCTACACTCTGTGGGAG
GAAGATTTGAAATGTATCAAACAGCTTGGATTGACTCATTACCGCTTCTCTCTTTCCTGG
TCACGTCTGTTACCTGATGGGACGACAGGTTTCATCAACCAGAAAGGAATTGATTATTAC
AACAAGATCATCGATGATTTGTTAAAAAATGGGGTTACTCCCATTGTGACCCTCTACCAC
TTTGATTTGCCTCAGACTTTAGAAGACCAAGGAGGTTGGTTGTCAGAGGCAATCATTGAA
TCCTTTGACAAATATGCTCAGTTTTGCTTCAGTACCTTTGGGGATCGTGTCAAGCAGTGG
ATCACCATAAATGAAGCTAATGTTCTTTCTGTGATGTCATATGACTTAGGTATGTTTCCT
CCGGGTATCCCTCACTTTGGGACTGGAGGTTATCAGGCAGCTCATAATTTGATTAAGGCT
CATGCCAGATCCTGGCACAGCTATGATTCCTTATTTCGAAAAAAGCAGAAAGGTATGGTG
TCTCTATCACTTTTTGCGGTCTGGTTGGAACCAGCAGATCCCAACTCAGTGTCTGACCAG
GAAGCTGCTAAAAGAGCCATCACTTTCCATCTGGATTTATTTGCTAAACCCATATTCATC
GATGGTGATTATCCTGAAGTTGTCAAGTCTCAGATTGCCTCCATGAGTCAAAAGCAAGGC
TATCCATCATCGAGGCTTCCAGAATTCACTGAAGAAGAGAAGAAAATGATCAAAGGCACT
GCTGATTTTTTTGCTGTGCAATATTATACAACTCGCTTAATCAAGTACCAGGAGAACAAG
AAAGGAGAACTAGGTATTCTCCAGGATGCGGAAATTGAATTTTTTCCAGATCCATCTTGG
AAAAATGTGGATTGGATCTACGTGGTACCATGGGGAGTATGTAAACTACTGAAATATATT
AAGGATACATATAATAACCCTGTAATTTACATCACTGAGAATGGGTTTCCCCAGAGTGAC
CCAGCGCCTCTTGATGACACTCAACGCTGGGAGTATTTCAGACAAACATTTCAGGAACTG
TTCAAAGCTATCCAACTTGATAAAGTCAATCTTCAAGTATATTGTGCATGGTCTCTTCTG
GATAACTTTGAGTGGAACCAGGGATACAGCAGCCGGTTTGGTCTCTTCCACGTTGATTTT
GAAGACCCAGCTAGACCCCGAGTCCCTTACACATCGGCCAAGGAATATGCCAAGATCATC
CGAAACAATGGCCTTGAAGCACATCTGTAG
Protein Properties
Number of Residues 469
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cytosolic beta-glucosidase
MAFPAGFGWAAATAAYQVEGGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWE
EDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYH
FDLPQTLEDQGGWLSEAIIESFDKYAQFCFSTFGDRVKQWITINEANVLSVMSYDLGMFP
PGIPHFGTGGYQAAHNLIKAHARSWHSYDSLFRKKQKGMVSLSLFAVWLEPADPNSVSDQ
EAAKRAITFHLDLFAKPIFIDGDYPEVVKSQIASMSQKQGYPSSRLPEFTEEEKKMIKGT
ADFFAVQYYTTRLIKYQENKKGELGILQDAEIEFFPDPSWKNVDWIYVVPWGVCKLLKYI
KDTYNNPVIYITENGFPQSDPAPLDDTQRWEYFRQTFQELFKAIQLDKVNLQVYCAWSLL
DNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAHL
GenBank ID Protein 11559218
UniProtKB/Swiss-Prot ID Q9H227
UniProtKB/Swiss-Prot Entry Name GBA3_HUMAN
PDB IDs
GenBank Gene ID AB017913
GeneCard ID GBA3
GenAtlas ID GBA3
HGNC ID HGNC:19069
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Yahata K, Mori K, Arai H, Koide S, Ogawa Y, Mukoyama M, Sugawara A, Ozaki S, Tanaka I, Nabeshima Y, Nakao K: Molecular cloning and expression of a novel klotho-related protein. J Mol Med (Berl). 2000;78(7):389-94. [PubMed:11043382 ]
  3. de Graaf M, van Veen IC, van der Meulen-Muileman IH, Gerritsen WR, Pinedo HM, Haisma HJ: Cloning and characterization of human liver cytosolic beta-glycosidase. Biochem J. 2001 Jun 15;356(Pt 3):907-10. [PubMed:11389701 ]
  4. Berrin JG, McLauchlan WR, Needs P, Williamson G, Puigserver A, Kroon PA, Juge N: Functional expression of human liver cytosolic beta-glucosidase in Pichia pastoris. Insights into its role in the metabolism of dietary glucosides. Eur J Biochem. 2002 Jan;269(1):249-58. [PubMed:11784319 ]
  5. Berrin JG, Czjzek M, Kroon PA, McLauchlan WR, Puigserver A, Williamson G, Juge N: Substrate (aglycone) specificity of human cytosolic beta-glucosidase. Biochem J. 2003 Jul 1;373(Pt 1):41-8. [PubMed:12667141 ]
  6. Nemeth K, Plumb GW, Berrin JG, Juge N, Jacob R, Naim HY, Williamson G, Swallow DM, Kroon PA: Deglycosylation by small intestinal epithelial cell beta-glucosidases is a critical step in the absorption and metabolism of dietary flavonoid glycosides in humans. Eur J Nutr. 2003 Jan;42(1):29-42. [PubMed:12594539 ]
  7. Hayashi Y, Okino N, Kakuta Y, Shikanai T, Tani M, Narimatsu H, Ito M: Klotho-related protein is a novel cytosolic neutral beta-glycosylceramidase. J Biol Chem. 2007 Oct 19;282(42):30889-900. Epub 2007 Jun 26. [PubMed:17595169 ]
  8. Tribolo S, Berrin JG, Kroon PA, Czjzek M, Juge N: The crystal structure of human cytosolic beta-glucosidase unravels the substrate aglycone specificity of a family 1 glycoside hydrolase. J Mol Biol. 2007 Jul 27;370(5):964-75. Epub 2007 May 18. [PubMed:17555766 ]
  9. Noguchi J, Hayashi Y, Baba Y, Okino N, Kimura M, Ito M, Kakuta Y: Crystal structure of the covalent intermediate of human cytosolic beta-glucosidase. Biochem Biophys Res Commun. 2008 Sep 26;374(3):549-52. doi: 10.1016/j.bbrc.2008.07.089. Epub 2008 Jul 26. [PubMed:18662675 ]
  10. Beutler E, Beutler L, West C: Mutations in the gene encoding cytosolic beta-glucosidase in Gaucher disease. J Lab Clin Med. 2004 Aug;144(2):65-8. [PubMed:15322500 ]