You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03074
Secondary Accession Numbers
  • 8610
Name Solute carrier family 12 member 7
Synonyms
  1. Electroneutral potassium-chloride cotransporter 4
  2. K-Cl cotransporter 4
Gene Name SLC12A7
Protein Type Transporter
Biological Properties
General Function Involved in transport
Specific Function Mediates electroneutral potassium-chloride cotransport when activated by cell swelling. May mediate K(+) uptake into Deiters' cells in the cochlea and contribute to K(+) recycling in the inner ear. Important for the survival of cochlear outer and inner hair cells and the maintenance of the organ of Corti. May be required for basolateral Cl(-) extrusion in the kidney and contribute to renal acidification
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
anion transmembrane transporter activity
anion:cation symporter activity
cation:chloride symporter activity
Process
sodium ion transport
establishment of localization
transport
chloride transport
transmembrane transport
anion transport
inorganic anion transport
monovalent inorganic cation transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:5
Locus 5p15
SNPs SLC12A7
Gene Sequence
>3252 bp
ATGCCCACCAACTTCACCGTGGTGCCCGTGGAGGCTCACGCCGACGGCGGCGGGGACGAG
ACTGCCGAGCGGACGGAGGCTCCGGGCACCCCCGAGGGCCCCGAGCCCGAGCGCCCCAGC
CCGGGAGATGGAAATCCAAGAGAAAACAGCCCATTCCTCAACAATGTCGAGGTGGAACAA
GAGAGCTTCTTTGAAGGGAAGAACATGGCACTTTTCGAGGAGGAGATGGACAGTAACCCC
ATGGTGTCCTCGCTGCTCAACAAGCTGGCCAACTACACCAACCTGAGCCAGGGCGTGGTG
GAGCACGAGGAGGACGAGGAGAGCCGGCGGCGGGAGGCCAAGGCTCCGCGCATGGGCACC
TTCATCGGCGTCTACCTGCCGTGCCTGCAGAACATCCTGGGCGTCATCCTCTTCCTGCGC
CTGACGTGGATCGTGGGGGTGGCTGGTGTCCTGGAGTCCTTCCTCATCGTGGCCATGTGC
TGCACATGTACAATGCTGACCGCCATTTCCATGAGTGCGATCGCTACCAACGGTGTGGTC
CCAGCTGGCGGGTCCTACTACATGATATCGCGCTCGCTGGGACCCGAGTTTGGAGGCGCT
GTCGGCCTCTGCTTCTACCTGGGCACGACGTTTGCAGGGGCCATGTATATTTTGGGGACC
ATCGAGATTTTTCTGACGTACATCTCCCCGGGTGCGGCCATCTTCCAGGCGGAGGCTGCA
GGTGGCGAGGCGGCCGCCATGCTGCACAACATGCGTGTGTACGGCACGTGCACGCTCGTG
CTCATGGCCCTGGTGGTCTTCGTGGGCGTCAAGTATGTCAACAAGCTGGCGCTGGTCTTC
CTGGCCTGCGTCGTGCTGTCCATCCTGGCCATCTATGCCGGCGTCATCAAGTCTGCCTTC
GACCCCCCGGACATCCCGGTCTGCCTCCTGGGGAACCGCACGCTGTCACGGCGCAGCTTC
GATGCCTGCGTCAAGGCCTACGGCATCCACAACAACTCAGCCACCTCCGCGCTCTGGGGC
CTCTTCTGCAACGGCTCCCAGCCCAGCGCCGCCTGTGACGAGTACTTCATCCAGAACAAC
GTCACCGAAATCCAGGGCATCCCGGGCGCGGCCAGTGGTGTCTTCCTGGAGAACCTGTGG
AGTACGTACGCGCACGCGGGGGCGTTTGTGGAGAAGAAAGGTGTGCCCTCGGTGCCCGTG
GCAGAGGAGAGCCGTGCCAGCGCACTGCCCTACGTGCTCACCGACATCGCGGCCTCCTTC
ACCCTGCTGGTTGGCATCTACTTCCCTTCCGTGACCGGTATCATGGCGGGTTCAAACCGG
TCCGGGGACCTCAAGGATGCACAGAAGTCCATCCCCACGGGGACCATCCTGGCCATAGTG
ACGACGTCTTTCATCTATCTCTCCTGCATTGTGCTGTTTGGGGCCTGCATTGAAGGCGTG
GTCTTACGAGATAAGTTCGGGGAGGCCCTGCAGGGGAACCTGGTCATCGGCATGCTGGCC
TGGCCCTCCCCCTGGGTCATCGTCATCGGCTCCTTCTTCTCCACCTGCGGTGCCGGCCTG
CAGAGCCTCACGGGGGCACCGCGCCTACTGCAGGCCATTGCCCGTGACGGCATCGTCCCC
TTCCTGCAGGTGTTTGGCCACGGGAAGGCCAACGGGGAGCCCACGTGGGCGCTGCTGCTG
ACAGTCCTCATCTGCGAGACTGGCATCCTCATCGCCTCTCTGGACAGCGTGGCCCCGATC
CTCTCCATGTTCTTCCTCATGTGCTACCTGTTCGTGAACCTGGCCTGCGCCGTGCAGACC
CTGCTACGTACCCCCAACTGGCGTCCACGCTTCAAGTTCTACCACTGGACCCTGTCCTTT
CTGGGTATGAGCCTGTGCCTGGCGCTGATGTTCATCTGCTCCTGGTACTACGCGCTGTCC
GCCATGCTCATCGCTGGCTGCATCTACAAGTACATCGAGTACCGCGGGGCCGAGAAGGAG
TGGGGCGATGGCATCCGTGGCCTATCCCTGAACGCCGCCCGCTACGCCCTGCTGCGCGTG
GAGCACGGTCCCCCCCACACCAAGAACTGGAGGCCCCAGGTGCTGGTGATGCTGAACCTG
GACGCGGAGCAGGCCGTGAAGCACCCCCGCCTGCTGTCCTTCACGTCGCAGCTGAAGGCC
GGCAAGGGCCTGACCATCGTGGGCTCGGTGCTGGAGGGGACGTACCTGGACAAGCACATG
GAGGCTCAGCGGGCCGAGGAGAACATACGGTCCCTAATGAGCACAGAGAAGACCAAGGGC
TTCTGCCAGCTGGTGGTCTCGTCCAGCCTGCGGGATGGCATGTCCCACCTGATCCAGTCG
GCCGGCCTGGGCGGCCTGAAGCACAACACGGTGCTCATGGCCTGGCCCGCATCCTGGAAG
CAGGAGGACAACCCCTTCTCCTGGAAGAACTTTGTGGACACCGTCCGCGACACCACCGCC
GCGCACCAGGCTCTGCTGGTGGCCAAGAACGTCGACTCGTTTCCGCAAAACCAGGAGCGC
TTCGGCGGGGGCCACATCGACGTGTGGTGGATCGTGCACGACGGCGGCATGCTCATGCTG
CTGCCCTTCCTGCTGCGCCAGCACAAGGTGTGGAGGAAGTGCCGGATGCGTATCTTCACC
GTGGCCCAGGTGGACGACAACAGCATCCAGATGAAGAAGGACCTGCAGATGTTCTTGTAC
CACTTGCGCATCAGCGCCGAGGTGGAGGTGGTGGAGATGGTTGAAAACGACATATCTGCT
TTCACCTACGAGAGGACACTAATGATGGAGCAGAGGTCGCAGATGCTGAAGCAGATGCAG
CTGTCCAAGAACGAGCAGGAGCGAGAGGCCCAGCTGATCCACGACAGGAACACCGCGTCC
CACACCGCGGCGGCAGCCAGGACCCAAGCGCCGCCTACGCCAGACAAGGTGCAGATGACC
TGGACCAGGGAGAAGCTGATCGCTGAGAAGTACAGGAGCAGAGACACCAGCCTATCTGGT
TTCAAAGACCTCTTCAGCATGAAGCCGGACCAGTCCAACGTCAGGCGGATGCACACGGCT
GTGAAGCTCAATGGCGTCGTCCTCAACAAGTCCCAGGATGCGCAGCTGGTCCTGCTCAAC
ATGCCAGGTCCTCCCAAAAACCGGCAGGGAGACGAGAACTACATGGAGTTTCTTGAAGTC
CTGACCGAGGGGCTGAACAGAGTCCTCCTGGTCAGGGGTGGCGGCCGGGAGGTGATCACC
ATCTACTCCTAA
Protein Properties
Number of Residues 1083
Molecular Weight 119104.8
Theoretical pI 6.7
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 119-139
  • 141-161
  • 215-235
  • 253-273
  • 276-296
  • 416-436
  • 457-477
  • 494-514
  • 554-574
  • 578-598
  • 625-645
  • 845-865
Protein Sequence
>Solute carrier family 12 member 7
MPTNFTVVPVEAHADGGGDETAERTEAPGTPEGPEPERPSPGDGNPRENSPFLNNVEVEQ
ESFFEGKNMALFEEEMDSNPMVSSLLNKLANYTNLSQGVVEHEEDEESRRREAKAPRMGT
FIGVYLPCLQNILGVILFLRLTWIVGVAGVLESFLIVAMCCTCTMLTAISMSAIATNGVV
PAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEIFLTYISPGAAIFQAEAA
GGEAAAMLHNMRVYGTCTLVLMALVVFVGVKYVNKLALVFLACVVLSILAIYAGVIKSAF
DPPDIPVCLLGNRTLSRRSFDACVKAYGIHNNSATSALWGLFCNGSQPSAACDEYFIQNN
VTEIQGIPGAASGVFLENLWSTYAHAGAFVEKKGVPSVPVAEESRASALPYVLTDIAASF
TLLVGIYFPSVTGIMAGSNRSGDLKDAQKSIPTGTILAIVTTSFIYLSCIVLFGACIEGV
VLRDKFGEALQGNLVIGMLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIARDGIVP
FLQVFGHGKANGEPTWALLLTVLICETGILIASLDSVAPILSMFFLMCYLFVNLACAVQT
LLRTPNWRPRFKFYHWTLSFLGMSLCLALMFICSWYYALSAMLIAGCIYKYIEYRGAEKE
WGDGIRGLSLNAARYALLRVEHGPPHTKNWRPQVLVMLNLDAEQAVKHPRLLSFTSQLKA
GKGLTIVGSVLEGTYLDKHMEAQRAEENIRSLMSTEKTKGFCQLVVSSSLRDGMSHLIQS
AGLGGLKHNTVLMAWPASWKQEDNPFSWKNFVDTVRDTTAAHQALLVAKNVDSFPQNQER
FGGGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAQVDDNSIQMKKDLQMFLY
HLRISAEVEVVEMVENDISAFTYERTLMMEQRSQMLKQMQLSKNEQEREAQLIHDRNTAS
HTAAAARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNVRRMHTA
VKLNGVVLNKSQDAQLVLLNMPGPPKNRQGDENYMEFLEVLTEGLNRVLLVRGGGREVIT
IYS
GenBank ID Protein 123701900
UniProtKB/Swiss-Prot ID Q9Y666
UniProtKB/Swiss-Prot Entry Name S12A7_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006598.2
GeneCard ID SLC12A7
GenAtlas ID SLC12A7
HGNC ID HGNC:10915
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  6. Hattori A, Okumura K, Nagase T, Kikuno R, Hirosawa M, Ohara O: Characterization of long cDNA clones from human adult spleen. DNA Res. 2000 Dec 31;7(6):357-66. [PubMed:11214971 ]
  7. Mount DB, Mercado A, Song L, Xu J, George AL Jr, Delpire E, Gamba G: Cloning and characterization of KCC3 and KCC4, new members of the cation-chloride cotransporter gene family. J Biol Chem. 1999 Jun 4;274(23):16355-62. [PubMed:10347194 ]
  8. Mercado A, Song L, Vazquez N, Mount DB, Gamba G: Functional comparison of the K+-Cl- cotransporters KCC1 and KCC4. J Biol Chem. 2000 Sep 29;275(39):30326-34. [PubMed:10913127 ]