You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03093
Secondary Accession Numbers
  • 8630
  • HMDBP03987
Name Methylmalonic aciduria type A protein, mitochondrial
Synonyms Not Available
Gene Name MMAA
Protein Type Enzyme
Biological Properties
General Function Involved in nucleotide binding
Specific Function Probable GTPase. May function as chaperone. May be involved in the transport of cobalamin (Cbl) into mitochondria for the final steps of adenosylcobalamin (AdoCbl) synthesis
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
nucleotide binding
catalytic activity
hydrolase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Mitochondrion (Probable)
Gene Properties
Chromosome Location Chromosome:4
Locus 4q31.21
SNPs MMAA
Gene Sequence
>1257 bp
ATGCCCATGCTGCTACCACATCCTCACCAGCATTTCCTAAAAGGCCTTTTAAGAGCACCT
TTCCGATGTTACCACTTCATCTTTCACTCAAGTACTCATCTCGGATCAGGAATCCCATGT
GCTCAGCCGTTTAATTCTCTTGGACTCCATTGTACAAAGTGGATGCTGCTGTCAGATGGC
TTAAAGAGAAAATTATGTGTACAAACAACCTTAAAGGACCACACAGAAGGACTTTCTGAT
AAAGAGCAAAGATTTGTGGATAAACTTTATACTGGTTTAATCCAAGGGCAAAGGGCCTGT
TTAGCAGAGGCCATAACTCTTGTAGAATCAACTCACAGCAGGAAAAAGGAGTTAGCCCAG
GTGCTTCTTCAGAAAGTATTACTTTACCACAGAGAACAAGAACAATCAAATAAAGGAAAA
CCACTAGCATTTCGAGTAGGATTGTCTGGGCCCCCTGGTGCTGGAAAATCAACATTTATA
GAATATTTTGGAAAAATGCTTACTGAGAGAGGGCACAAATTATCTGTGCTAGCTGTGGAC
CCTTCTTCTTGTACTAGTGGTGGATCACTCTTAGGTGATAAAACCCGAATGACTGAGTTA
TCAAGAGATATGAATGCATACATCAGGCCATCTCCTACTAGAGGAACTTTAGGAGGCGTG
ACAAGGACCACAAATGAAGCTATTCTGTTGTGTGAAGGAGCGGGATATGACATAATTCTT
ATTGAAACCGTTGGTGTGGGTCAGTCGGAGTTTGCTGTTGCTGACATGGTTGACATGTTT
GTTTTACTACTGCCACCAGCAGGAGGAGATGAGCTGCAGGGTATCAAAAGGGGTATAATC
GAGATGGCAGATCTGGTAGCTGTAACTAAATCTGATGGAGACTTGATTGTGCCAGCTCGA
AGGATACAAGCGGAATATGTGAGTGCACTGAAATTACTCCGCAAACGTTCACAAGTCTGG
AAACCAAAGGTAATTCGTATTTCTGCCCGAAGTGGAGAGGGGATCTCTGAAATGTGGGAT
AAAATGAAAGATTTCCAGGACCTAATGCTTGCCAGTGGGGAGCTGACTGCCAAACGACGG
AAGCAACAGAAAGTTTGGATGTGGAATCTCATTCAGGAAAGTGTGTTAGAGCATTTCAGG
ACCCACCCCACAGTCCGGGAACAGATTCCACTTCTGGAACAAAAGGTTCTCATTGGGGCC
CTGTCCCCAGGACTAGCAGCAGACTTCTTGTTAAAAGCTTTTAAAAGCAGAGACTAA
Protein Properties
Number of Residues 418
Molecular Weight 46537.9
Theoretical pI 9.83
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Methylmalonic aciduria type A protein, mitochondrial
MPMLLPHPHQHFLKGLLRAPFRCYHFIFHSSTHLGSGIPCAQPFNSLGLHCTKWMLLSDG
LKRKLCVQTTLKDHTEGLSDKEQRFVDKLYTGLIQGQRACLAEAITLVESTHSRKKELAQ
VLLQKVLLYHREQEQSNKGKPLAFRVGLSGPPGAGKSTFIEYFGKMLTERGHKLSVLAVD
PSSCTSGGSLLGDKTRMTELSRDMNAYIRPSPTRGTLGGVTRTTNEAILLCEGAGYDIIL
IETVGVGQSEFAVADMVDMFVLLLPPAGGDELQGIKRGIIEMADLVAVTKSDGDLIVPAR
RIQAEYVSALKLLRKRSQVWKPKVIRISARSGEGISEMWDKMKDFQDLMLASGELTAKRR
KQQKVWMWNLIQESVLEHFRTHPTVREQIPLLEQKVLIGALSPGLAADFLLKAFKSRD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IVH4
UniProtKB/Swiss-Prot Entry Name MMAA_HUMAN
PDB IDs Not Available
GenBank Gene ID AK126662
GeneCard ID MMAA
GenAtlas ID MMAA
HGNC ID HGNC:18871
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dobson CM, Wai T, Leclerc D, Wilson A, Wu X, Dore C, Hudson T, Rosenblatt DS, Gravel RA: Identification of the gene responsible for the cblA complementation group of vitamin B12-responsive methylmalonic acidemia based on analysis of prokaryotic gene arrangements. Proc Natl Acad Sci U S A. 2002 Nov 26;99(24):15554-9. Epub 2002 Nov 15. [PubMed:12438653 ]
  4. Lerner-Ellis JP, Dobson CM, Wai T, Watkins D, Tirone JC, Leclerc D, Dore C, Lepage P, Gravel RA, Rosenblatt DS: Mutations in the MMAA gene in patients with the cblA disorder of vitamin B12 metabolism. Hum Mutat. 2004 Dec;24(6):509-16. [PubMed:15523652 ]
  5. Yang X, Sakamoto O, Matsubara Y, Kure S, Suzuki Y, Aoki Y, Suzuki Y, Sakura N, Takayanagi M, Iinuma K, Ohura T: Mutation analysis of the MMAA and MMAB genes in Japanese patients with vitamin B(12)-responsive methylmalonic acidemia: identification of a prevalent MMAA mutation. Mol Genet Metab. 2004 Aug;82(4):329-33. [PubMed:15308131 ]