You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03097
Secondary Accession Numbers
  • 8634
Name Phosphoethanolamine/phosphocholine phosphatase
Synonyms Not Available
Gene Name PHOSPHO1
Protein Type Unknown
Biological Properties
General Function Involved in phosphatase activity
Specific Function Phosphatase that has a high activity toward phosphoethanolamine (PEA) and phosphocholine (PCho). Involved in the generation of inorganic phosphate for bone mineralization.
Pathways
  • Glycerophospholipid metabolism
  • Phospholipid Biosynthesis
Reactions
O-Phosphoethanolamine + Water → Ethanolamine + Phosphoric acid details
Phosphorylcholine + Water → Choline + Phosphoric acid details
GO Classification
Biological Process
phosphatidylethanolamine biosynthetic process
phosphatidylcholine biosynthetic process
regulation of bone mineralization
Cellular Component
cytosol
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
metal ion binding
phosphocholine phosphatase activity
phosphoethanolamine phosphatase activity
pyrophosphatase activity
Process
metabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 17
Locus 17q21.32
SNPs PHOSPHO1
Gene Sequence
>804 bp
ATGAGTGGCTGTTTTCCAGTTTCTGGCCTCCGCTGCCTATCTAGGGACGGCAGGATGGCC
GCGCAGGGCGCGCCGCGCTTCCTCCTGACCTTCGACTTCGACGAGACTATCGTGGACGAA
AACAGCGACGATTCGATCGTGCGCGCCGCGCCGGGCCAGCGGCTCCCGGAGAGCCTGCGA
GCCACCTACCGCGAGGGCTTCTACAACGAGTACATGCAGCGCGTCTTCAAGTACCTGGGC
GAGCAGGGCGTGCGGCCGCGGGACCTGAGCGCCATCTACGAAGCCATCCCTTTGTCGCCA
GGCATGAGCGACCTGCTGCAGTTTGTGGCAAAACAGGGCGCCTGCTTCGAGGTGATTCTC
ATCTCCGATGCCAACACCTTTGGCGTGGAGAGCTCGCTGCGCGCCGCCGGCCACCACAGC
CTGTTCCGCCGCATCCTCAGCAACCCGTCGGGGCCGGATGCGCGGGGACTGCTGGCTCTG
CGGCCGTTCCACACACACAGCTGCGCGCGCTGCCCCGCCAACATGTGCAAGCACAAGGTG
CTCAGCGACTACCTGCGCGAGCGGGCCCACGACGGCGTGCACTTCGAGCGCCTCTTCTAC
GTGGGCGACGGCGCCAACGACTTCTGCCCCATGGGGCTGCTGGCGGGCGGCGACGTGGCC
TTCCCGCGCCGCGGCTACCCCATGCACCGCCTCATTCAGGAGGCCCAGAAGGCCGAGCCC
AGCTCGTTCCGCGCCAGCGTGGTGCCCTGGGAAACGGCTGCAGATGTGCGCCTCCACCTG
CAACAGGTGCTGAAGTCGTGCTGA
Protein Properties
Number of Residues 267
Molecular Weight 32350.505
Theoretical pI 7.65
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Phosphoethanolamine/phosphocholine phosphatase
MSGCFPVSGLRCLSRDGRMAAQGAPRFLLTFDFDETIVDENSDDSIVRAAPGQRLPESLR
ATYREGFYNEYMQRVFKYLGEQGVRPRDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVIL
ISDANTFGVESSLRAAGHHSLFRRILSNPSGPDARGLLALRPFHTHSCARCPANMCKHKV
LSDYLRERAHDGVHFERLFYVGDGANDFCPMGLLAGGDVAFPRRGYPMHRLIQEAQKAEP
SSFRASVVPWETAADVRLHLQQVLKSC
GenBank ID Protein 20196839
UniProtKB/Swiss-Prot ID Q8TCT1
UniProtKB/Swiss-Prot Entry Name PHOP1_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ457189
GeneCard ID PHOSPHO1
GenAtlas ID PHOSPHO1
HGNC ID HGNC:16815
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Houston B, Paton IR, Burt DW, Farquharson C: Chromosomal localization of the chicken and mammalian orthologues of the orphan phosphatase PHOSPHO1 gene. Anim Genet. 2002 Dec;33(6):451-4. [PubMed:12464021 ]
  3. Roberts SJ, Stewart AJ, Sadler PJ, Farquharson C: Human PHOSPHO1 exhibits high specific phosphoethanolamine and phosphocholine phosphatase activities. Biochem J. 2004 Aug 15;382(Pt 1):59-65. [PubMed:15175005 ]
  4. Houston B, Stewart AJ, Farquharson C: PHOSPHO1-A novel phosphatase specifically expressed at sites of mineralisation in bone and cartilage. Bone. 2004 Apr;34(4):629-37. [PubMed:15050893 ]
  5. Stewart AJ, Schmid R, Blindauer CA, Paisey SJ, Farquharson C: Comparative modelling of human PHOSPHO1 reveals a new group of phosphatases within the haloacid dehalogenase superfamily. Protein Eng. 2003 Dec;16(12):889-95. [PubMed:14983068 ]
  6. Roberts SJ, Stewart AJ, Schmid R, Blindauer CA, Bond SR, Sadler PJ, Farquharson C: Probing the substrate specificities of human PHOSPHO1 and PHOSPHO2. Biochim Biophys Acta. 2005 Aug 31;1752(1):73-82. [PubMed:16054448 ]