Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03104
Secondary Accession Numbers
  • 8642
  • HMDBP07234
Name Mitochondrial glutamate carrier 2
Synonyms
  1. GC-2
  2. Glutamate/H(+) symporter 2
  3. Solute carrier family 25 member 18
Gene Name SLC25A18
Protein Type Enzyme
Biological Properties
General Function Involved in binding
Specific Function Involved in the transport of glutamate across the inner mitochondrial membrane. Glutamate is cotransported with H(+).
Pathways Not Available
Reactions Not Available
GO Classification
Cellular Component
integral to membrane
mitochondrial inner membrane
Component
membrane
cell part
organelle membrane
organelle inner membrane
mitochondrial inner membrane
Function
binding
Molecular Function
symporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Mitochondrion inner membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 22
Locus 22q11.2
SNPs SLC25A18
Gene Sequence
>948 bp
ATGACCCACCAGGATCTGAGCATCACAGCCAAACTCATCAATGGAGGTGTAGCAGGGCTC
GTGGGGGTGACCTGCGTGTTCCCCATCGACTTGGCCAAGACTCGCCTGCAGAACCAGCAT
GGGAAAGCCATGTACAAAGGAATGATCGACTGCCTGATGAAGACGGCTCGGGCGGAGGGC
TTCTTCGGCATGTACCGAGGGGCTGCAGTGAACCTCACTCTGGTCACTCCAGAGAAGGCC
ATCAAGCTGGCGGCCAACGACTTTTTCCGGCGGCTGCTCATGGAAGATGGGATGCAGCGG
AACCTGAAGATGGAGATGCTTGCCGGGTGTGGGGCTGGGATGTGCCAGGTCGTGGTGACC
TGTCCCATGGAAATGCTCAAGATTCAGCTGCAGGATGCTGGACGCCTGGCCGTCCATCAT
CAGGGCTCGGCCTCAGCACCCTCCACCTCCAGGTCCTACACAACTGGTTCGGCTTCCACC
CACAGGCGCCCCTCTGCCACCCTCATTGCCTGGGAGCTGCTCCGCACTCAGGGCCTGGCT
GGGCTCTACAGGGGCCTGGGTGCCACTCTCCTCAGAGACATTCCTTTCTCCATCATCTAC
TTCCCACTGTTTGCCAACCTTAACAACCTGGGGTTCAACGAGCTCGCCGGTAAGGCGTCC
TTTGCACATTCCTTCGTGTCAGGCTGTGTGGCAGGTTCCATAGCTGCGGTCGCAGTGACG
CCTCTAGATGTTCTGAAAACTCGAATCCAAACCCTCAAGAAAGGCCTGGGCGAGGACATG
TACAGTGGGATCACCGACTGTGCCAGGAAACTCTGGATTCAGGAGGGACCATCTGCCTTC
ATGAAAGGCGCTGGCTGCCGGGCACTGGTCATAGCACCTCTCTTTGGGATTGCTCAAGGG
GTCTATTTTATTGGGATTGGAGAGCGCATCTTAAAGTGTTTTGACTAG
Protein Properties
Number of Residues 315
Molecular Weight 33848.44
Theoretical pI 9.242
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Mitochondrial glutamate carrier 2
MTHQDLSITAKLINGGVAGLVGVTCVFPIDLAKTRLQNQHGKAMYKGMIDCLMKTARAEG
FFGMYRGAAVNLTLVTPEKAIKLAANDFFRRLLMEDGMQRNLKMEMLAGCGAGMCQVVVT
CPMEMLKIQLQDAGRLAVHHQGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLA
GLYRGLGATLLRDIPFSIIYFPLFANLNNLGFNELAGKASFAHSFVSGCVAGSIAAVAVT
PLDVLKTRIQTLKKGLGEDMYSGITDCARKLWIQEGPSAFMKGAGCRALVIAPLFGIAQG
VYFIGIGERILKCFD
GenBank ID Protein 21322707
UniProtKB/Swiss-Prot ID Q9H1K4
UniProtKB/Swiss-Prot Entry Name GHC2_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ428203
GeneCard ID SLC25A18
GenAtlas ID SLC25A18
HGNC ID HGNC:10988
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  3. Fiermonte G, Palmieri L, Todisco S, Agrimi G, Palmieri F, Walker JE: Identification of the mitochondrial glutamate transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution of two human isoforms. J Biol Chem. 2002 May 31;277(22):19289-94. Epub 2002 Mar 15. [PubMed:11897791 ]
  4. Footz TK, Brinkman-Mills P, Banting GS, Maier SA, Riazi MA, Bridgland L, Hu S, Birren B, Minoshima S, Shimizu N, Pan H, Nguyen T, Fang F, Fu Y, Ray L, Wu H, Shaull S, Phan S, Yao Z, Chen F, Huan A, Hu P, Wang Q, Loh P, Qi S, Roe BA, McDermid HE: Analysis of the cat eye syndrome critical region in humans and the region of conserved synteny in mice: a search for candidate genes at or near the human chromosome 22 pericentromere. Genome Res. 2001 Jun;11(6):1053-70. [PubMed:11381032 ]