You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03110
Secondary Accession Numbers
  • 8650
  • HMDBP04326
Name Neutral amino acid transporter A
Synonyms
  1. ASCT-1
  2. Alanine/serine/cysteine/threonine transporter 1
  3. SATT
  4. Solute carrier family 1 member 4
Gene Name SLC1A4
Protein Type Unknown
Biological Properties
General Function Involved in sodium:dicarboxylate symporter activity
Specific Function Transporter for alanine, serine, cysteine, and threonine. Exhibits sodium dependence
Pathways
  • Argininemia
  • Argininosuccinic Aciduria
  • Carbamoyl Phosphate Synthetase Deficiency
  • Citrullinemia Type I
  • Glucose-Alanine Cycle
  • Glutaminolysis and Cancer
  • Ornithine Transcarbamylase Deficiency (OTC Deficiency)
  • Urea Cycle
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
transporter activity
organic acid transmembrane transporter activity
carboxylic acid transmembrane transporter activity
dicarboxylic acid transmembrane transporter activity
sodium:dicarboxylate symporter activity
Process
establishment of localization
transport
organic acid transport
carboxylic acid transport
dicarboxylic acid transport
Cellular Location
  1. Melanosome
  2. Membrane
  3. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 2p15-p13
SNPs SLC1A4
Gene Sequence
>1596 bp
ATGGCCCTGGGTGAAGAAAAGGCAGAAGCGGAAGCATCTGAAGACACAAAGGCCCAGTCC
TATGGGAGAGGGAGCTGCAGGGAGCGGGAGCTGGACATCCCAGGGCCCATGAGTGGGGAG
CAGCCCCCACGCCTGGAAGCTGAGGGAGGGCTCATCTCCCCTGTATGGGGGGCAGAAGGG
ATACCTGCCCCTACTTGCTGGATTGGGACTGACCCTGGCGGCCCCTCTAGAGCCCACCAG
CCACAGGCCAGTGATGCCAACAGAGAGCCCGTAGCTGAGAGGTCTGAGCCTGCACTCAGT
GGCCTGCCTCCTGCCACCATGGGGTCTGGAGACCTTCTGCTCTCCGGGGAAAGCCAGGTG
GAGAAGACCAAGCTTTCTTCCTCCGAGGAGTTCCCTCAGACTCTGAGCCTTCCCAGAACA
ACAACTATTTGCTCAGGACATGATGCTGATACCGAAGATGATCCATCCCTAGCAGATTTG
CCCCAGGCACTGGACCTCAGCCAGCAGCCTCACAGCTCAGGTCTCTCTTGCCTGTCACAG
TGGAAGTCCGTGCTGAGCCCAGGTTCCGCAGCTCAGCCTTCCAGCTGCAGCATCTCTGCT
TCCTCCACAGGCAGCAGTCTCCAGGGTCACCAGGAGAGGGCGGAGCCTCGTGGTGGTTCT
CTGGCCAAGGTCTCCTCCTCCCTGGAGCCGGTCGTCCCCCAGGAACCTTCCTCTGTGGTG
GGGCTAGGACCTCGGCCCCAGTGGTCACCACAGCCTGTGTTCTCTGGGGGTGATGCTTCT
GGGCTAGGCAGGAGACGCCTCTCCTTCCAGGCTGAGTACTGGGCCTGTGTGCTGCCAGAT
TCCCTGCCTCCATCACCCGACCGCCACTCCCCTCTCTGGAACCCAAATAAAGAGTATGAA
GATCTGCTTGACTATACTTACCCACTGAGGCCCGGGCCTCAGCTCCCAAAGCACCTTGAT
AGCCGTGTGCCAGCTGACCCTGTCCTGCAGGACTCCGGGGTAGACCTGGATAGCTTCTCT
GTCTCTCCAGCAAGCACCCTCAAATCACCTACTAATGTCTCCCCCAACTGCCCACCAGCA
GAGGCCACTGCCCTGCCATTTTCTGGGCCCAGAGAGCCAAGCCTTAAGCAGTGGCCCTCC
AGAGTACCCCAGAAACAGGGTGGCATGGGCTTGGCATCTTGGAGCCAACTTGCATCTACC
CCCAGAGCCCCAGGCAGTAGGGATGCTCGTTGGGAGCGCAGAGAGCCAGCCCTGAGGGGT
GCGAAGGACCGGCTGACTATAGGCAAGCACCTTGATATGGGCTCTCCCCAGCTAAGGACA
CGGGACAGAGGGTGGCCCTCGCCCAGGCCAGAGAGGGAGAAGAGGACCAGCCAGAGTGCC
CGGCGCCCTACCTGCACAGAGTCTAGGTGGAAATCAGAAGAGGAAGTGGAAAGTGATGAC
GAGTATCTTGCCCTCCCCGCTCGGCTGACACAGACATTTTGCTGTCAGCTGGAAGAGCTG
ATCTGCTGGCTGTATAATGTTGCAGATGTTACTGACCACGGGACTGCAGCCAGGTCCAAT
CTTACAAGTCTCAAGTCTTCTCTGCAGCTTTACCGG
Protein Properties
Number of Residues 532
Molecular Weight 55722.5
Theoretical pI 6.18
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 42-62
  • 88-108
  • 119-139
  • 217-237
  • 257-277
  • 298-318
  • 328-348
  • 373-393
  • 418-438
Protein Sequence
>Neutral amino acid transporter A
MEKSNETNGYLDSAQAGPAAGPGAPGTAAGRARRCAGFLRRQALVLLTVSGVLAGAGLGA
ALRGLSLSRTQVTYLAFPGEMLLRMLRMIILPLVVCSLVSGAASLDASCLGRLGGIAVAY
FGLTTLSASALAVALAFIIKPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFP
SNLVVAAFRTYATDYKVVTQNSSSGNVTHEKIPIGTEIEGMNILGLVLFALVLGVALKKL
GSEGEDLIRFFNSLNEATMVLVSWIMWYVPVGIMFLVGSKIVEMKDIIVLVTSLGKYIFA
SILGHVIHGGIVLPLIYFVFTRKNPFRFLLGLLAPFATAFATCSSSATLPSMMKCIEENN
GVDKRISRFILPIGATVNMDGAAIFQCVAAVFIAQLNNVELNAGQIFTILVTATASSVGA
AGVPAGGVLTIAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQK
ATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL
GenBank ID Protein 62822396
UniProtKB/Swiss-Prot ID P43007
UniProtKB/Swiss-Prot Entry Name SATT_HUMAN
PDB IDs Not Available
GenBank Gene ID AC007386
GeneCard ID SLC1A4
GenAtlas ID SLC1A4
HGNC ID HGNC:10942
References
General References
  1. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Chi A, Valencia JC, Hu ZZ, Watabe H, Yamaguchi H, Mangini NJ, Huang H, Canfield VA, Cheng KC, Yang F, Abe R, Yamagishi S, Shabanowitz J, Hearing VJ, Wu C, Appella E, Hunt DF: Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes. J Proteome Res. 2006 Nov;5(11):3135-44. [PubMed:17081065 ]
  6. Arriza JL, Kavanaugh MP, Fairman WA, Wu YN, Murdoch GH, North RA, Amara SG: Cloning and expression of a human neutral amino acid transporter with structural similarity to the glutamate transporter gene family. J Biol Chem. 1993 Jul 25;268(21):15329-32. [PubMed:8101838 ]
  7. Shafqat S, Tamarappoo BK, Kilberg MS, Puranam RS, McNamara JO, Guadano-Ferraz A, Fremeau RT Jr: Cloning and expression of a novel Na(+)-dependent neutral amino acid transporter structurally related to mammalian Na+/glutamate cotransporters. J Biol Chem. 1993 Jul 25;268(21):15351-5. [PubMed:8340364 ]
  8. Hofmann K, Duker M, Fink T, Lichter P, Stoffel W: Human neutral amino acid transporter ASCT1: structure of the gene (SLC1A4) and localization to chromosome 2p13-p15. Genomics. 1994 Nov 1;24(1):20-6. [PubMed:7896285 ]