Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03145
Secondary Accession Numbers
  • 8695
  • HMDBP07041
Name Cytochrome c oxidase subunit 6A2, mitochondrial
Synonyms
  1. COX VIa-M
  2. COXVIAH
  3. Cytochrome c oxidase polypeptide VIa-heart
  4. Cytochrome c oxidase subunit VIA-muscle
Gene Name COX6A2
Protein Type Enzyme
Biological Properties
General Function Involved in cytochrome-c oxidase activity
Specific Function This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
organelle membrane
organelle inner membrane
mitochondrial inner membrane
mitochondrial membrane part
mitochondrial respiratory chain complex iv
Function
catalytic activity
oxidoreductase activity
heme-copper terminal oxidase activity
cytochrome-c oxidase activity
Cellular Location
  1. Mitochondrion inner membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 16p
SNPs COX6A2
Gene Sequence
>294 bp
ATGGCTTTGCCTCTGAGGCCCCTGACCCGGGGCTTGGCCAGCGCTGCCAAAGGAGGCCAC
GGAGGAGCAGGAGCTCGTACCTGGCGTCTGCTGACCTTCGTGCTGGCGCTGCCCAGCGTG
GCCCTCTGCACCTTCAACTCCTATCTCCACTCGGGCCACCGCCCGCGCCCCGAGTTCCGT
CCCTACCAACACCTCCGCATCCGCACCAAGCCCTACCCCTGGGGGGACGGCAACCACACT
CTGTTCCACAATAGCCACGTGAACCCTCTGCCCACGGGCTACGAACACCCCTGA
Protein Properties
Number of Residues 97
Molecular Weight 10815.3
Theoretical pI 11.37
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cytochrome c oxidase subunit 6A2, mitochondrial
MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFR
PYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP
GenBank ID Protein 20987428
UniProtKB/Swiss-Prot ID Q02221
UniProtKB/Swiss-Prot Entry Name CX6A2_HUMAN
PDB IDs Not Available
GenBank Gene ID BC029818
GeneCard ID COX6A2
GenAtlas ID COX6A2
HGNC ID HGNC:2279
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Fabrizi GM, Sadlock J, Hirano M, Mita S, Koga Y, Rizzuto R, Zeviani M, Schon EA: Differential expression of genes specifying two isoforms of subunit VIa of human cytochrome c oxidase. Gene. 1992 Oct 1;119(2):307-12. [PubMed:1327966 ]
  3. Bachman NJ, Riggs PK, Siddiqui N, Makris GJ, Womack JE, Lomax MI: Structure of the human gene (COX6A2) for the heart/muscle isoform of cytochrome c oxidase subunit VIa and its chromosomal location in humans, mice, and cattle. Genomics. 1997 May 15;42(1):146-51. [PubMed:9177785 ]