You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03167
Secondary Accession Numbers
  • 8723
  • HMDBP04320
Name Folate receptor gamma
Synonyms
  1. FR-gamma
  2. Folate receptor 3
Gene Name FOLR3
Protein Type Enzyme
Biological Properties
General Function Involved in folic acid binding
Specific Function Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Isoform Short does not bind folate
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13
SNPs FOLR3
Gene Sequence
>732 bp
ATGGCCTGGCAGATGATGCAGCTGCTGCTTCTGGCTTTGGTGACTGCTGCGGGGAGTGCC
CAGCCCAGGAGTGCGCGGGCCAGGACGGACCTGCTCAATGTCTGCATGAACGCCAAGCAC
CACAAGACACAGCCCAGCCCCGAGGACGAGCTGTATGGCCAGTGCAGTCCCTGGAAGAAG
AATGCCTGCTGCACGGCCAGCACCAGCCAGGAGCTGCACAAGGACACCTCCCGCCTGTAC
AACTTTAACTGGGATCACTGTGGTAAGATGGAACCCACCTGCAAGCGCCACTTTATCCAG
GACAGCTGTCTCTATGAGTGCTCACCCAACCTGGGGCCCTGGATCCGGCAGGTCAACCAG
AGCTGGCGCAAAGAGCGCATTCTGAACGTGCCCCTGTGCAAAGAGGACTGTGAGCGCTGG
TGGGAGGACTGTCGCACCTCCTACACCTGCAAAAGCAACTGGCACAAAGGCTGGAATTGG
ACCTCAGGGATTAATGAGTGTCCGGCCGGGGCCCTCTGCAGCACCTTTGAGTCCTACTTC
CCCACTCCAGCCGCCCTTTGTGAAGGCCTCTGGAGCCACTCCTTCAAGGTCAGCAACTAT
AGTCGAGGGAGCGGCCGCTGCATCCAGATGTGGTTTGACTCAGCCCAGGGCAACCCCAAT
GAGGAGGTGGCCAAGTTCTATGCTGCGGCCATGAATGCTGGGGCCCCGTCTCGTGGGATT
ATTGATTCCTGA
Protein Properties
Number of Residues 243
Molecular Weight 27638.0
Theoretical pI 7.88
Pfam Domain Function
Signals
  • 1-23
Transmembrane Regions
  • None
Protein Sequence
>Folate receptor gamma
MAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKK
NACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQ
SWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYF
PTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGI
IDS
GenBank ID Protein 473236
UniProtKB/Swiss-Prot ID P41439
UniProtKB/Swiss-Prot Entry Name FOLR3_HUMAN
PDB IDs Not Available
GenBank Gene ID Z32564
GeneCard ID FOLR3
GenAtlas ID FOLR3
HGNC ID HGNC:3795
References
General References
  1. Hillman RT, Green RE, Brenner SE: An unappreciated role for RNA surveillance. Genome Biol. 2004;5(2):R8. Epub 2004 Feb 2. [PubMed:14759258 ]
  2. Shen F, Ross JF, Wang X, Ratnam M: Identification of a novel folate receptor, a truncated receptor, and receptor type beta in hematopoietic cells: cDNA cloning, expression, immunoreactivity, and tissue specificity. Biochemistry. 1994 Feb 8;33(5):1209-15. [PubMed:8110752 ]
  3. Shen F, Wu M, Ross JF, Miller D, Ratnam M: Folate receptor type gamma is primarily a secretory protein due to lack of an efficient signal for glycosylphosphatidylinositol modification: protein characterization and cell type specificity. Biochemistry. 1995 Apr 25;34(16):5660-5. [PubMed:7727426 ]