Hmdb loader
Survey
Identification
HMDB Protein ID HMDBP03200
Secondary Accession Numbers
  • 8764
Name Cytochrome c oxidase subunit 7B2, mitochondrial
Synonyms
  1. Cytochrome c oxidase polypeptide VIIb2
Gene Name COX7B2
Protein Type Enzyme
Biological Properties
General Function Involved in cytochrome-c oxidase activity
Specific Function This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
mitochondrial membrane part
mitochondrial respiratory chain
Function
catalytic activity
oxidoreductase activity
heme-copper terminal oxidase activity
cytochrome-c oxidase activity
Cellular Location
  1. Mitochondrion inner membrane
Gene Properties
Chromosome Location Chromosome:4
Locus 4p12
SNPs COX7B2
Gene Sequence
>246 bp
ATGATGTTTCCCTTGGCCAGAAATGCACTAAGCAGTCTCAAGATTCAAAGCATTCTGCAA
AGCATGGCAAGACATAGCCATGTAAAACACTCACCAGATTTTCATGATAAATATGGTAAT
GCTGTGCTAGCCAGTGGAACTGCTTTCTGTGTTGCTACATGGGTGTTTACAGCCACTCAG
ATTGGAATAGAATGGAACCTATCCCCTGTTGGCAGAGTTACCCCAAAAGAGTGGAAACAT
CAGTAA
Protein Properties
Number of Residues 81
Molecular Weight 9077.4
Theoretical pI 10.37
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 34-60
Protein Sequence
>Cytochrome c oxidase subunit 7B2, mitochondrial
MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ
IGIEWNLSPVGRVTPKEWKHQ
GenBank ID Protein 115527068
UniProtKB/Swiss-Prot ID Q8TF08
UniProtKB/Swiss-Prot Entry Name CX7B2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_130902.2
GeneCard ID COX7B2
GenAtlas ID COX7B2
HGNC ID HGNC:24381
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Liang H, Chen H, Shen Y, Feng Q, Jin W, Huang W, Zeng Y: A rare polymorphism of the COX7B2 gene in a Cantonese family with nasopharyngeal carcinoma. Sci China C Life Sci. 2004 Oct;47(5):449-53. [PubMed:15623157 ]