You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03202
Secondary Accession Numbers
  • 8766
  • HMDBP05561
Name Solute carrier organic anion transporter family member 4A1
Synonyms
  1. Colon organic anion transporter
  2. OATP-E
  3. OATP-RP1
  4. OATP4A1
  5. OATPRP1
  6. Organic anion transporter polypeptide-related protein 1
  7. Organic anion-transporting polypeptide E
  8. POAT
  9. Sodium-independent organic anion transporter E
  10. Solute carrier family 21 member 12
Gene Name SLCO4A1
Protein Type Transporter
Biological Properties
General Function Involved in transporter activity
Specific Function Mediates the Na(+)-independent transport of organic anions such as the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and of estrone-3-sulfate and taurocholate
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transporter activity
Process
establishment of localization
transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 20q13.33
SNPs SLCO4A1
Gene Sequence
>2169 bp
ATGCCCCTGCATCAGCTGGGGGACAAGCCGCTCACCTTCCCCAGCCCCAACTCAGCCATG
GAAAACGGGCTTGACCACACCCCACCCAGCAGGAGGGCATCCCCGGGCACACCCCTGAGC
CCCGGCTCCCTCCGCTCCGCTGCCCATAGCCCCCTGGACACCAGCAAGCAGCCCCTCTGC
CAGCTCTGGGCCGAGAAGCATGGCGCCCGGGGGACCCATGAGGTGCGGTACGTCTCGGCC
GGGCAGAGCGTGGCGTGCGGCTGGTGGGCCTTCGCACCGCCGTGCCTGCAGGTCCTCAAC
ACGCCCAAGGGCATCCTGTTCTTCCTGTGTGCGGCCGCATTCCTGCAGGGGATGACTGTG
AATGGCTTCATCAACACAGTCATCACCTCCCTGGAGCGCCGCTATGACCTGCACAGCTAC
CAGAGCGGGCTCATCGCCAGCTCCTACGACATTGCCGCCTGCCTCTGCCTCACCTTCGTC
AGCTACTTCGGGGGCTCAGGGCACAAGCCGCGCTGGCTGGGCTGGGGCGTGCTGCTTATG
GGCACGGGGTCGCTGGTGTTCGCGCTGCCCCACTTCACGGCTGGCCGCTATGAGGTGGAG
TTGGACGCGGGTGTCAGGACGTGCCCTGCCAACCCCGGCGCGGTGTGTGCGGACAGCACC
TCGGGCCTGTCCCGCTACCAGCTGGTCTTCATGCTGGGCCAGTTCCTGCATGGCGTGGGT
GCCACACCCCTCTACACGCTGGGCGTCACCTACCTGGATGAGAACGTCAAGTCCAGCTGC
TCGCCCGTCTACATTGCCATCTTCTACACAGCGGCCATCCTGGGCCCAGCTGCCGGCTAC
CTGATTGGAGGTGCCCTGCTGAATATCTACACGGAAATGGGCCGACGGACGGAGCTGACC
ACCGAGAGCCCACTGTGGGTCGGCGCCTGGTGGGTCGGCTTCCTGGGCTCTGGGGCCGCT
GCTTTCTTCACCGCCGTTCCCATCCTTGGTTACCCTCGGCAGCTGCCAGGCTCCCAGCGC
TACGCGGTCATGAGAGCGGCGGAAATGCACCAGTTGAAGGACAGCAGCCGTGGGGAGGCG
AGCAACCCGGACTTTGGGAAAACCATCAGAGACCTGCCTCTCTCCATCTGGCTCCTGCTG
AAGAACCCCACGTTCATCCTGCTCTGCCTGGCCGGGGCCACCGAGGCCACTCTCATCACC
GGCATGTCCACGTTCAGCCCCAAGTTCTTGGAGTCCCAGTTCAGCCTGAGTGCCTCAGAA
GCTGCCACCTTGTTTGGGTACCTGGTGGTGCCAGCGGGTGGTGGCGGCACCTTCCTGGGC
GGCTTCTTTGTGAACAAGCTCAGGCTCCGGGGCTCCGCGGTCATCAAGTTCTGCCTGTTC
TGCACCGTTGTCAGCCTGCTGGGCATCCTCGTCTTCTCACTGCACTGCCCCAGTGTGCCC
ATGGCGGGCGTCACAGCCAGCTACGGCGGGAGCCTCCTGCCCGAAGGCCACCTGAACCTA
ACGGCTCCCTGCAACGCTGCCTGCAGCTGCCAGCCAGAACACTACAGCCCTGTGTGCGGC
TCGGACGGCCTCATGTACTTCTCACTGTGCCACGCAGGGTGCCCTGCAGCCACGGAGACG
AATGTGGACGGCCAGAAGGTGTACCGAGACTGTAGCTGTATCCCTCAGAATCTTTCCTCT
GGTTTTGGCCATGCCACTGCAGGGAAATGCACTTCAACTTGTCAGAGAAAGCCCCTCCTT
CTGGTTTTCATATTCGTTGTAATTTTCTTTACATTCCTCAGCAGCATTCCTGCACTAACG
GCAACTCTACGATGTGTCCGTGACCCTCAGAGATCCTTTGCCCTGGGAATCCAGTGGATT
GTAGTTAGAATACTAGGGGGCATCCCGGGGCCCATCGCCTTCGGCTGGGTGATCGACAAG
GCCTGTCTGCTGTGGCAGGACCAGTGTGGCCAGCAGGGCTCCTGCTTGGTGTACCAGAAT
TCGGCCATGAGCCGCTACATACTCATCATGGGGCTCCTGTACAAGGTGCTGGGCGTCCTC
TTCTTTGCCATAGCCTGCTTCTTATACAAGCCCCTGTCGGAGTCTTCAGATGGCCTGGAA
ACTTGTCTGCCCAGCCAGTCCTCAGCCCCTGACAGTGCCACAGATAGCCAGCTCCAGAGC
AGCGTCTGA
Protein Properties
Number of Residues 722
Molecular Weight 77192.5
Theoretical pI 7.85
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 104-124
  • 144-164
  • 172-192
  • 229-249
  • 263-283
  • 309-329
  • 372-392
  • 424-444
  • 454-474
  • 579-599
  • 617-637
  • 667-687
Protein Sequence
>Solute carrier organic anion transporter family member 4A1
MPLHQLGDKPLTFPSPNSAMENGLDHTPPSRRASPGTPLSPGSLRSAAHSPLDTSKQPLC
QLWAEKHGARGTHEVRYVSAGQSVACGWWAFAPPCLQVLNTPKGILFFLCAAAFLQGMTV
NGFINTVITSLERRYDLHSYQSGLIASSYDIAACLCLTFVSYFGGSGHKPRWLGWGVLLM
GTGSLVFALPHFTAGRYEVELDAGVRTCPANPGAVCADSTSGLSRYQLVFMLGQFLHGVG
ATPLYTLGVTYLDENVKSSCSPVYIAIFYTAAILGPAAGYLIGGALLNIYTEMGRRTELT
TESPLWVGAWWVGFLGSGAAAFFTAVPILGYPRQLPGSQRYAVMRAAEMHQLKDSSRGEA
SNPDFGKTIRDLPLSIWLLLKNPTFILLCLAGATEATLITGMSTFSPKFLESQFSLSASE
AATLFGYLVVPAGGGGTFLGGFFVNKLRLRGSAVIKFCLFCTVVSLLGILVFSLHCPSVP
MAGVTASYGGSLLPEGHLNLTAPCNAACSCQPEHYSPVCGSDGLMYFSLCHAGCPAATET
NVDGQKVYRDCSCIPQNLSSGFGHATAGKCTSTCQRKPLLLVFIFVVIFFTFLSSIPALT
ATLRCVRDPQRSFALGIQWIVVRILGGIPGPIAFGWVIDKACLLWQDQCGQQGSCLVYQN
SAMSRYILIMGLLYKVLGVLFFAIACFLYKPLSESSDGLETCLPSQSSAPDSATDSQLQS
SV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96BD0
UniProtKB/Swiss-Prot Entry Name SO4A1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB031051
GeneCard ID SLCO4A1
GenAtlas ID SLCO4A1
HGNC ID HGNC:10953
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  7. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  8. Tamai I, Nezu J, Uchino H, Sai Y, Oku A, Shimane M, Tsuji A: Molecular identification and characterization of novel members of the human organic anion transporter (OATP) family. Biochem Biophys Res Commun. 2000 Jun 24;273(1):251-60. [PubMed:10873595 ]
  9. Fujiwara K, Adachi H, Nishio T, Unno M, Tokui T, Okabe M, Onogawa T, Suzuki T, Asano N, Tanemoto M, Seki M, Shiiba K, Suzuki M, Kondo Y, Nunoki K, Shimosegawa T, Iinuma K, Ito S, Matsuno S, Abe T: Identification of thyroid hormone transporters in humans: different molecules are involved in a tissue-specific manner. Endocrinology. 2001 May;142(5):2005-12. [PubMed:11316767 ]