You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03222
Secondary Accession Numbers
  • 8787
  • HMDBP03489
Name High affinity cationic amino acid transporter 1
Synonyms
  1. CAT-1
  2. CAT1
  3. ERR
  4. Ecotropic retroviral leukemia receptor homolog
  5. Ecotropic retrovirus receptor homolog
  6. Solute carrier family 7 member 1
  7. System Y+ basic amino acid transporter
Gene Name SLC7A1
Protein Type Enzyme
Biological Properties
General Function Involved in transport
Specific Function High-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. May also function as an ecotropic retroviral leukemia receptor
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
active transmembrane transporter activity
transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
transporter activity
Process
establishment of localization
transport
amine transport
amino acid transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 13q12-q14
SNPs SLC7A1
Gene Sequence
>1890 bp
ATGGGGTGCAAAGTCCTGCTCAACATTGGGCAGCAGATGCTGCGGCGGAAGGTGGTGGAC
TGTAGCCGGGAGGAGACGCGGCTGTCTCGCTGCCTGAACACTTTTGATCTGGTGGCCCTC
GGGGTGGGCAGCACACTGGGTGCTGGTGTCTACGTCCTGGCTGGAGCTGTGGCCCGTGAG
AATGCAGGCCCTGCCATTGTCATCTCCTTCCTGATCGCTGCGCTGGCCTCAGTGCTGGCT
GGCCTGTGCTATGGCGAGTTTGGTGCTCGGGTCCCCAAGACGGGCTCAGCTTACCTCTAC
AGCTATGTCACCGTTGGAGAGCTCTGGGCCTTCATCACCGGCTGGAACTTAATCCTCTCC
TACATCATCGGTACTTCAAGCGTAGCGAGGGCCTGGAGCGCCACCTTCGACGAGCTGATA
GGCAGACCCATCGGGGAGTTCTCACGGACACACATGACTCTGAACGCCCCCGGCGTGCTG
GCTGAAAACCCCGACATATTCGCAGTGATCATAATTCTCATCTTGACAGGACTTTTAACT
CTTGGTGTGAAAGAGTCGGCCATGGTCAACAAAATATTCACTTGTATTAACGTCCTGGTC
CTGGGCTTCATAATGGTGTCAGGATTTGTGAAAGGATCGGTTAAAAACTGGCAGCTCACG
GAGGAGGATTTTGGGAACACATCAGGCCGTCTCTGTTTGAACAATGACACAAAAGAAGGG
AAGCCCGGTGTTGGTGGATTCATGCCCTTCGGGTTCTCTGGTGTCCTGTCGGGGGCAGCG
ACTTGCTTCTATGCCTTCGTGGGCTTTGACTGCATCGCCACCACAGGTGAAGAGGTGAAG
AACCCACAGAAGGCCATCCCCGTGGGGATCGTGGCGTCCCTCTTGATCTGCTTCATCGCC
TACTTTGGGGTGTCGGCTGCCCTCACGCTCATGATGCCCTACTTCTGCCTGGACAATAAC
AGCCCCCTGCCCGACGCCTTTAAGCACGTGGGCTGGGAAGGTGCCAAGTACGCAGTGGCC
GTGGGCTCCCTCTGCGCTCTTTCCGCCAGTCTTCTAGGTTCCATGTTTCCCATGCCTCGG
GTTATCTATGCCATGGCTGAGGATGGACTGCTATTTAAATTCTTAGCCAACGTCAATGAT
AGGACCAAAACACCAATAATCGCCACATTAGCCTCGGGTGCCGTTGCTGCTGTGATGGCC
TTCCTCTTTGACCTGAAGGACTTGGTGGACCTCATGTCCATTGGCACTCTCCTGGCTTAC
TCGTTGGTGGCTGCCTGTGTGTTGGTCTTACGGTACCAGCCAGAGCAGCCTAACCTGGTA
TACCAGATGGCCAGTACTTCCGACGAGTTAGATCCAGCAGACCAAAATGAATTGGCAAGC
ACCAATGATTCCCAGCTGGGGTTTTTACCAGAGGCAGAGATGTTCTCTTTGAAAACCATA
CTCTCACCCAAAAACATGGAGCCTTCCAAAATCTCTGGGCTAATTGTGAACATTTCAACC
AGCCTTATAGCTGTTCTCATCATCACCTTCTGCATTGTGACCGTGCTTGGAAGGGAGGCT
CTCACCAAAGGGGCGCTGTGGGCAGTCTTTCTGCTCGCAGGGTCTGCCCTCCTCTGTGCC
GTGGTCACGGGCGTCATCTGGAGGCAGCCCGAGAGCAAGACCAAGCTCTCATTTAAGGTT
CCCTTCCTGCCAGTGCTCCCCATCCTGAGCATCTTCGTGAACGTCTATCTCATGATGCAG
CTGGACCAGGGCACCTGGGTCCGGTTTGCTGTGTGGATGCTGATAGGCTTCATCATCTAC
TTTGGCTATGGCCTGTGGCACAGCGAGGAGGCGTCCCTGGATGCCGACCAAGCAAGGACT
CCTGACGGCAACTTGGACCAGTGCAAGTGA
Protein Properties
Number of Residues 629
Molecular Weight 67637.6
Theoretical pI 5.06
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 36-57
  • 62-82
  • 103-123
  • 163-183
  • 192-212
  • 247-267
  • 288-307
  • 338-358
  • 385-405
  • 409-429
  • 493-513
  • 527-551
  • 560-580
  • 585-605
Protein Sequence
>High affinity cationic amino acid transporter 1
MGCKVLLNIGQQMLRRKVVDCSREETRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARE
NAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILS
YIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNAPGVLAENPDIFAVIIILILTGLLT
LGVKESAMVNKIFTCINVLVLGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEG
KPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIA
YFGVSAALTLMMPYFCLDNNSPLPDAFKHVGWEGAKYAVAVGSLCALSASLLGSMFPMPR
VIYAMAEDGLLFKFLANVNDRTKTPIIATLASGAVAAVMAFLFDLKDLVDLMSIGTLLAY
SLVAACVLVLRYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTI
LSPKNMEPSKISGLIVNISTSLIAVLIITFCIVTVLGREALTKGALWAVFLLAGSALLCA
VVTGVIWRQPESKTKLSFKVPFLPVLPILSIFVNVYLMMQLDQGTWVRFAVWMLIGFIIY
FGYGLWHSEEASLDADQARTPDGNLDQCK
GenBank ID Protein 36161
UniProtKB/Swiss-Prot ID P30825
UniProtKB/Swiss-Prot Entry Name CTR1_HUMAN
PDB IDs Not Available
GenBank Gene ID X59155
GeneCard ID SLC7A1
GenAtlas ID SLC7A1
HGNC ID HGNC:11057
References
General References
  1. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  4. Yoshimoto T, Yoshimoto E, Meruelo D: Molecular cloning and characterization of a novel human gene homologous to the murine ecotropic retroviral receptor. Virology. 1991 Nov;185(1):10-7. [PubMed:1718082 ]
  5. Albritton LM, Bowcock AM, Eddy RL, Morton CC, Tseng L, Farrer LA, Cavalli-Sforza LL, Shows TB, Cunningham JM: The human cationic amino acid transporter (ATRC1): physical and genetic mapping to 13q12-q14. Genomics. 1992 Mar;12(3):430-4. [PubMed:1348489 ]
  6. Kamath SG, Furesz TC, Way BA, Smith CH: Identification of three cationic amino acid transporters in placental trophoblast: cloning, expression, and characterization of hCAT-1. J Membr Biol. 1999 Sep 1;171(1):55-62. [PubMed:10485994 ]