You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03231
Secondary Accession Numbers
  • 8798
Name Sodium bicarbonate cotransporter 3
Synonyms
  1. Bicarbonate transporter
  2. Sodium bicarbonate cotransporter 2
  3. Sodium bicarbonate cotransporter 2b
  4. Solute carrier family 4 member 7
Gene Name SLC4A7
Protein Type Transporter
Biological Properties
General Function Involved in anion transport
Specific Function Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na(+):HCO3(-) 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
auditory receptor cell development
cochlear nucleus development
retina vasculature morphogenesis in camera-type eye
retinal cell programmed cell death
Cellular Component
plasma membrane
stereocilium
basolateral plasma membrane
apical plasma membrane
integral to membrane
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
inorganic anion exchanger activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
anion:anion antiporter activity
transporter activity
anion transmembrane transporter activity
Molecular Function
inorganic anion exchanger activity
sodium:bicarbonate symporter activity
Process
establishment of localization
transport
anion transport
ion transport
Cellular Location
  1. Multi-pass membrane protein
  2. Multi-pass membrane protein
  3. Basolateral cell membrane
  4. Apical cell membrane
  5. Cell projection
  6. stereocilium
Gene Properties
Chromosome Location 3
Locus 3p22
SNPs SLC4A7
Gene Sequence
>3645 bp
ATGGAAAGATTTCGTCTGGAGAAGAAGTTACCTGGTCCTGATGAAGAAGCTGTTGTGGAT
CTTGGCAAAACTAGCTCAACTGTGAACACCAAGTTTGAAAAAGAAGAACTAGAAAGTCAT
AGAGCTGTATATATTGGTGTTCACGTCCCGTTTAGTAAAGAGAGTCGTCGGCGTCATAGG
CATCGCGGACACAAACATCACCACCGGAGAAGAAAAGATAAAGAATCAGATAAAGAAGAT
GGACGGGAATCTCCTTCTTATGATACACCATCCCAGAGAGTTCAGTTTATCCTTGGTACT
GAAGATGATGATGAAGAACATATTCCCCATGATCTCTTCACGGAAATGGATGAACTGTGT
TACAGAGATGGAGAAGAATATGAATGGAAAGAAACTGCTAGATGGCTGAAATTTGAAGAG
GATGTTGAAGATGGCGGTGACCGATGGAGTAAACCTTATGTGGCAACTCTCTCTTTGCAC
AGTCTTTTTGAACTAAGGAGTTGCATCCTCAATGGAACAGTCATGCTGGATATGAGAGCA
AGCACTCTAGATGAAATAGCAGATATGGTATTAGACAACATGATAGCTTCTGGCCAATTA
GACGAGTCCATACGAGAGAATGTCAGAGAAGCTCTTCTGAAGAGACATCATCATCAGAAT
GAGAAAAGATTCACCAGTCGGATTCCTCTTGTTCGATCTTTTGCAGATATAGGCAAGAAA
CATTCTGACCCTCACTTGCTTGAAAGGAATGGGGAAGGCCTTTCAGCCTCCCGCCACTCT
TTGCGAACAGGTCTGTCTGCCTCAAACCTTTCCTTGAGAGGAGAATCACCTTTATCTCTT
CTTCTTGGTCATCTTCTTCCTTCTTCAAGAGCTGGAACCCCTGCAGGCTCAAGGTGTACA
ACCCCAGTACCCACCCCTCAAAACAGTCCTCCTTCTAGCCCTAGCATCAGCCGCCTGACC
TCCAGAAGTTCCCAAGAGAGTCAGCGTCAGGCCCCAGAACTACTGGTTTCACCTGCCAGT
GATGATATTCCCACAGTAGTAATTCATCCGCCTGAGGAAGACTTAGAAGCAGCGCTGAAA
GGCGAGGAGCAGAAGAATGAGGAAAATGTTGACTTAACTCCAGGTATTTTGGCCTCTCCC
CAGTCTGCTCCTGGAAACTTGGACAATAGTAAAAGTGGAGAAATTAAAGGTAATGGAAGT
GGTGGAAGCAGAGAAAATAGTACTGTTGACTTCAGCAAGGTTGATATGAATTTCATGAGA
AAAATTCCTACGGGTGCTGAGGCATCCAACGTCCTGGTGGGCGAAGTAGACTTTTTGGAA
AGGCCAATAATTGCATTTGTGAGACTGGCTCCTGCTGTCCTCCTTACAGGGTTGACTGAG
GTCCCTGTTCCAACCAGGTTTTTGTTTTTGTTATTGGGTCCAGCGGGCAAGGCACCACAG
TACCATGAAATTGGACGATCAATAGCCACTCTCATGACAGATGAGATTTTCCATGATGTA
GCTTATAAAGCAAAAGACAGAAATGACCTCTTATCTGGAATTGATGAATTTTTAGATCAA
GTAACTGTCCTACCTCCAGGAGAGTGGGATCCTTCTATACGCATAGAACCACCAAAAAGT
GTCCCTTCTCAGGAAAAGAGAAAGATTCCTGTGTTTCACAATGGATCTACCCCCACACTG
GGTGAGACTCCTAAAGAGGCCGCTCATCATGCTGGGCCTGAGCTACAGAGGACTGGACGG
CTTTTTGGTGGTTTGATACTTGACATCAAAAGGAAAGCACCTTTTTTCTTGAGTGACTTC
AAGGATGCATTAAGCCTGCAGTGCCTGGCCTCGATTCTTTTCCTATACTGTGCCTGTATG
TCTCCTGTAATCACTTTTGGAGGGCTGCTTGGAGAAGCTACAGAAGGCAGAATAAGTGCA
ATAGAGTCTCTTTTTGGAGCATCATTAACTGGGATTGCCTATTCATTGTTTGCTGGGCAA
CCTCTAACAATATTGGGGAGCACAGGTCCAGTTCTAGTGTTTGAAAAAATTTTATATAAA
TTCTGCAGAGATTATCAACTTTCTTATCTGTCTTTAAGAACCAGTATTGGTCTGTGGACT
TCTTTTTTGTGCATTGTTTTGGTTGCAACAGATGCAAGCAGCCTTGTGTGTTATATTACT
CGATTTACAGAAGAGGCTTTTGCAGCCCTTATTTGCATCATATTCATCTACGAGGCTTTG
GAGAAGCTCTTTGATTTAGGAGAAACATATGCATTTAATATGCACAACAACTTAGATAAA
CTGACCAGCTACTCATGTGTATGTACTGAACCTCCAAACCCCAGCAATGAAACTCTAGCA
CAATGGAAGAAAGATAATATAACAGCACACAATATTTCCTGGAGAAATCTTACTGTTTCT
GAATGTAAAAAACTTCGTGGTGTATTCTTGGGGTCAGCTTGTGGTCATCATGGACCTTAT
ATTCCAGATGTGCTCTTTTGGTGTGTCATCTTGTTTTTCACAACATTTTTTCTGTCTTCA
TTCCTCAAGCAATTTAAGACCAAGCGTTACTTTCCTACCAAGGTGCGATCGACAATCAGT
GATTTTGCTGTATTTCTCACAATAGTAATAATGGTTACAATTGACTACCTTGTAGGAGTT
CCATCTCCTAAACTTCATGTTCCTGAAAAATTTGAGCCTACTCATCCAGAGAGAGGGTGG
ATCATAAGCCCACTGGGAGATAATCCTTGGTGGACCTTATTAATAGCTGCTATTCCTGCT
TTGCTTTGTACCATTCTCATCTTTATGGATCAACAAATCACAGCTGTAATTATAAACAGA
AAGGAACACAAATTGAAGAAAGGAGCTGGCTATCACCTTGATTTGCTCATGGTTGGCGTT
ATGTTGGGAGTTTGCTCTGTCATGGGACTTCCATGGTTTGTGGCTGCAACAGTGTTGTCA
ATAAGTCATGTCAACAGCTTAAAAGTTGAATCTGAATGTTCTGCTCCAGGGGAACAACCC
AAGTTTTTGGGAATTCGTGAACAGCGGGTTACAGGGCTAATGATTTTTATTCTAATGGGC
CTCTCTGTGTTCATGACTTCAGTCCTAAAGTTTATTCCAATGCCTGTTCTGTATGGTGTT
TTCCTTTATATGGGAGTTTCCTCATTAAAAGGAATCCAGTTATTTGACCGTATAAAATTA
TTTGGAATGCCTGCTAAGCATCAGCCTGATTTGATATACCTCCGTTATGTGCCGCTCTGG
AAGGTCCATATTTTCACAGTCATTCAGCTTACTTGTTTGGTCCTTTTATGGGTGATAAAA
GTTTCAGCTGCTGCAGTGGTTTTTCCCATGATGGTTCTTGCATTAGTGTTTGTGCGCAAA
CTCATGGACCTGTGTTTCACGAAGAGAGAACTTAGTTGGCTTGATGATCTTATGCCAGAA
AGTAAGAAAAAGAAAGAAGATGACAAAAAGAAAAAAGAGAAAGAGGAAGCTGAACGGATG
CTTCAAGATGATGATGATACTGTGCACCTTCCATTTGAAGGGGGAAGTCTCTTGCAAATT
CCAGTCAAGGCCCTAAAATATAGTCCTGATAAACCTGTGAGTGTGAAAATAAGTTTTGAA
GATGAACCAAGAAAGAAATACGTGGATGCTGAAACTTCATTATAG
Protein Properties
Number of Residues 1214
Molecular Weight 127358.16
Theoretical pI 6.754
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium bicarbonate cotransporter 3
MERFRLEKKLPGPDEEAVVDLGKTSSTVNTKFEKEELESHRAVYIGVHVPFSKESRRRHR
HRGHKHHHRRRKDKESDKEDGRESPSYDTPSQRVQFILGTEDDDEEHIPHDLFTEMDELC
YRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRA
STLDEIADMVLDNMIASGQLDESIRENVREALLKRHHHQNEKRFTSRIPLVRSFADIGKK
HSDPHLLERNGEGLSASRHSLRTGLSASNLSLRGESPLSLLLGHLLPSSRAGTPAGSRCT
TPVPTPQNSPPSSPSISRLTSRSSQESQRQAPELLVSPASDDIPTVVIHPPEEDLEAALK
GEEQKNEENVDLTPGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKVDMNFMR
KIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLTGLTEVPVPTRFLFLLLGPAGKAPQ
YHEIGRSIATLMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKS
VPSQEKRKIPVFHNGSTPTLGETPKEAAHHAGPELQRTGRLFGGLILDIKRKAPFFLSDF
KDALSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASLTGIAYSLFAGQ
PLTILGSTGPVLVFEKILYKFCRDYQLSYLSLRTSIGLWTSFLCIVLVATDASSLVCYIT
RFTEEAFAALICIIFIYEALEKLFDLGETYAFNMHNNLDKLTSYSCVCTEPPNPSNETLA
QWKKDNITAHNISWRNLTVSECKKLRGVFLGSACGHHGPYIPDVLFWCVILFFTTFFLSS
FLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVTIDYLVGVPSPKLHVPEKFEPTHPERGW
IISPLGDNPWWTLLIAAIPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLLMVGV
MLGVCSVMGLPWFVAATVLSISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILMG
LSVFMTSVLKFIPMPVLYGVFLYMGVSSLKGIQLFDRIKLFGMPAKHQPDLIYLRYVPLW
KVHIFTVIQLTCLVLLWVIKVSAAAVVFPMMVLALVFVRKLMDLCFTKRELSWLDDLMPE
SKKKKEDDKKKKEKEEAERMLQDDDDTVHLPFEGGSLLQIPVKALKYSPDKPVSVKISFE
DEPRKKYVDAETSL
GenBank ID Protein 134288865
UniProtKB/Swiss-Prot ID Q9Y6M7
UniProtKB/Swiss-Prot Entry Name S4A7_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_003615.3
GeneCard ID SLC4A7
GenAtlas ID SLC4A7
HGNC ID HGNC:11033
References
General References
  1. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  6. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  7. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. [PubMed:15144186 ]
  8. Pushkin A, Abuladze N, Newman D, Muronets V, Sassani P, Tatishchev S, Kurtz I: The COOH termini of NBC3 and the 56-kDa H+-ATPase subunit are PDZ motifs involved in their interaction. Am J Physiol Cell Physiol. 2003 Mar;284(3):C667-73. Epub 2002 Nov 20. [PubMed:12444018 ]
  9. Park M, Ko SB, Choi JY, Muallem G, Thomas PJ, Pushkin A, Lee MS, Kim JY, Lee MG, Muallem S, Kurtz I: The cystic fibrosis transmembrane conductance regulator interacts with and regulates the activity of the HCO3- salvage transporter human Na+-HCO3- cotransport isoform 3. J Biol Chem. 2002 Dec 27;277(52):50503-9. Epub 2002 Oct 25. [PubMed:12403779 ]
  10. Loiselle FB, Morgan PE, Alvarez BV, Casey JR: Regulation of the human NBC3 Na+/HCO3- cotransporter by carbonic anhydrase II and PKA. Am J Physiol Cell Physiol. 2004 Jun;286(6):C1423-33. Epub 2004 Jan 21. [PubMed:14736710 ]
  11. Ishibashi K, Sasaki S, Marumo F: Molecular cloning of a new sodium bicarbonate cotransporter cDNA from human retina. Biochem Biophys Res Commun. 1998 May 19;246(2):535-8. [PubMed:9610397 ]
  12. Pushkin A, Abuladze N, Lee I, Newman D, Hwang J, Kurtz I: Cloning, tissue distribution, genomic organization, and functional characterization of NBC3, a new member of the sodium bicarbonate cotransporter family. J Biol Chem. 1999 Jun 4;274(23):16569-75. [PubMed:10347222 ]
  13. Reiners J, van Wijk E, Marker T, Zimmermann U, Jurgens K, te Brinke H, Overlack N, Roepman R, Knipper M, Kremer H, Wolfrum U: Scaffold protein harmonin (USH1C) provides molecular links between Usher syndrome type 1 and type 2. Hum Mol Genet. 2005 Dec 15;14(24):3933-43. Epub 2005 Nov 21. [PubMed:16301216 ]