You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03241
Secondary Accession Numbers
  • 8813
  • HMDBP03888
Name Glutamine-dependent NAD(+) synthetase
Synonyms
  1. NAD(+) synthase [glutamine-hydrolyzing]
  2. NAD(+) synthetase
Gene Name NADSYN1
Protein Type Unknown
Biological Properties
General Function Involved in NAD+ synthase (glutamine-hydrolyzing) activity
Specific Function Not Available
Pathways
  • 2-Hydroxyglutric Aciduria (D And L Form)
  • 4-Hydroxybutyric Aciduria/Succinic Semialdehyde Dehydrogenase Deficiency
  • Glutamate Metabolism
  • Homocarnosinosis
  • Hyperinsulinism-Hyperammonemia Syndrome
  • NAD(+) biosynthesis
  • Nicotinate and Nicotinamide Metabolism
  • Nicotinate and nicotinamide metabolism
  • Succinic semialdehyde dehydrogenase deficiency
Reactions
Adenosine triphosphate + Nicotinic acid adenine dinucleotide + L-Glutamine + Water → Adenosine monophosphate + Pyrophosphate + NAD + L-Glutamic acid details
GO Classification
Biological Process
NAD biosynthetic process
water-soluble vitamin metabolic process
NAD metabolic process
Cellular Component
cytosol
Function
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
ligase activity
carbon-nitrogen ligase activity, with glutamine as amido-n-donor
ligase activity, forming carbon-nitrogen bonds
nad+ synthase (glutamine-hydrolyzing) activity
Molecular Function
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
NAD+ synthase (glutamine-hydrolyzing) activity
ATP binding
Process
metabolic process
nitrogen compound metabolic process
coenzyme biosynthetic process
pyridine nucleotide biosynthetic process
nicotinamide nucleotide biosynthetic process
nad biosynthetic process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 11
Locus 11q13.4
SNPs NADSYN1
Gene Sequence
>2121 bp
ATGGGCCGGAAGGTGACCGTGGCCACCTGCGCACTCAACCAGTGGGCCCTGGACTTCGAG
GGCAATTTGCAAAGAATTTTAAAGAGTATTGAAATTGCCAAAAACAGAGGAGCAAGATAC
AGGCTTGGACCAGAGCTGGAAATATGCGGCTACGGATGTTGGGATCATTATTACGAGTCG
GACACCCTCTTGCACTCGTTTCAAGTCCTAGCGGCCCTTGTGGAGTCTCCCGTCACTCAG
GACATCATCTGCGACGTGGGGATGCCTGTAATGCACCGAAACGTCCGCTACAACTGCAGA
GTGGTATTCCTCAACAGGAAGATCCTGCTCATCAGACCCAAGATGGCCTTGGCCAATGAA
GGCAACTACCGCGAGCTGCGCTGGTTCACCCCGTGGTCGAGGAGTCGGCACACAGAGGAG
TACTTTCTGCCTCGGATGATACAGGACCTGACAAAGCAGGAAACCGTACCCTTCGGAGAT
GCGGTGCTGGTGACATGGGACACCTGCATTGGAAGTGAGATCTGTGAGGAGCTCTGGACA
CCCCACAGCCCGCACATCGACATGGGCCTGGATGGCGTGGAGATCATCACCAACGCCTCG
GGCAGCCACCACGTGCTGCGCAAAGCCAACACCAGGGTGGATCTCGTGACTATGGTCACC
AGCAAGAACGGTGGGATTTACTTGCTGGCCAACCAGAAGGGTTGCGACGGGGACCGCCTG
TACTACGACGGCTGTGCCATGATCGCCATGAACGGAAGCGTCTTTGCTCAAGGATCCCAG
TTTTCTCTGGATGACGTGGAAGTCCTGACGGCCACGCTGGATCTGGAGGACGTCCGGAGC
TACAGGGCGGAGATTTCATCTCGAAACCTGGCGGCCAGCAGGGCGAGCCCCTACCCCAGA
GTGAAGGTGGACTTTGCCCTCTCGTGCCACGAGGACTTGCTGGCACCCATCTCTGAGCCC
ATCGAGTGGAAATACCACAGCCCTGAGGAGGAGATAAGCCTTGGACCTGCCTGCTGGCTC
TGGGATTTTTTAAGACGAAGTCAACAGGCAGGGTTTTTGCTGCCCTTGAGTGGCGGGGTG
GACAGCGCAGCCACCGCCTGCCTCATCTACTCCATGTGCTGCCAGGTCTGCGAGGCCGTG
AGGAGTGGAAATGAGGAAGTGCTGGCTGATGTCCGCACCATCGTGAACCAGATCAGCTAC
ACCCCCCAGGATCCCCGAGACCTCTGTGGACGCATACTGACCACCTGCTACATGGCCAGC
AAGAACTCCTCCCAGGAGACGTGCACCCGGGCCAGAGAGTTGGCCCAGCAGATTGGAAGC
CACCACATCAGTCTCAACATCGATCCAGCCGTGAAGGCCGTCATGGGCATCTTCAGCCTG
GTGACGGGGAAGAGCCCTCTGTTTGCAGCTCATGGAGGAAGCAGCAGGGAAAACCTGGCG
CTGCAAAATGTGCAGGCTCGAATACGGATGGTCCTCGCCTATCTGTTTGCTCAGTTGAGC
CTCTGGTCTCGGGGTGTCCACGGTGGGCTCCTCGTGCTGGGATCCGCCAACGTGGATGAG
AGTCTCCTGGGCTACCTGACCAAGTACGACTGCTCCAGTGCGGACATCAACCCCATAGGC
GGGATCAGCAAGACGGACCTCAGGGCCTTCGTCCAGTTCTGCATCCAGCGCTTCCAGCTT
CCTGCCCTGCAGAGCATCCTGTTGGCGCCGGCCACCGCAGAGCTGGAGCCCTTGGCTGAT
GGACAGGTGTCCCAGACCGACGAGGAAGATATGGGGATGACATATGCGGAGCTCTCGGTC
TATGGGAAACTCAGGAAGGTGGCCAAGATGGGGCCCTACAGCATGTTCTGCAAACTCCTC
GGCATGCGGAGACACATCTGCACCCCGAGACAGGTCGCTGACAAAGTGAAGCGGTTTTTC
TCCAAGTACTCCATGAACAGACACAAGATGACCACGCTCACACCCGCGTACCACGCCGAG
AACTACAGCCCTGAGGACAACAGGTTTGATCTGCGACCATTTCTGTACAACACAAGCTGG
CCTTGGCAGTTTCGGTGCATAGAAAATCAGGTGCTACAGCTCGAGAGGGCAGAGCCACAG
TCCCTGGACGGCGTGGACTGA
Protein Properties
Number of Residues 706
Molecular Weight 79283.945
Theoretical pI 6.442
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Glutamine-dependent NAD(+) synthetase
MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKNRGARYRLGPELEICGYGCWDHYYES
DTLLHSFQVLAALVESPVTQDIICDVGMPVMHRNVRYNCRVIFLNRKILLIRPKMALANE
GNYRELRWFTPWSRSRHTEEYFLPRMIQDLTKQETVPFGDAVLVTWDTCIGSEICEELWT
PHSPHIDMGLDGVEIITNASGSHQVLRKANTRVDLVTMVTSKNGGIYLLANQKGCDGDRL
YYDGCAMIAMNGSVFAQGSQFSLDDVEVLTATLDLEDVRSYRAEISSRNLAASRASPYPR
VKVDFALSCHEDLLAPISEPIEWKYHSPEEEISLGPACWLWDFLRRSQQAGFLLPLSGGV
DSAATACLIYSMCCQVCEAVRSGNEEVLADVRTIVNQISYTPQDPRDLCGRILTTCYMAS
KNSSQETCTRARELAQQIGSHHISLNIDPAVKAVMGIFSLVTGKSPLFAAHGGSSRENLA
LQNVQARIRMVLAYLFAQLSLWSRGVHGGLLVLGSANVDESLLGYLTKYDCSSADINPIG
GISKTDLRAFVQFCIQRFQLPALQSILLAPATAELEPLADGQVSQTDEEDMGMTYAELSV
YGKLRKVAKMGPYSMFCKLLGMWRHICTPRQVADKVKRFFSKYSMNRHKMTTLTPAYHAE
NYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDGVD
GenBank ID Protein 28849201
UniProtKB/Swiss-Prot ID Q6IA69
UniProtKB/Swiss-Prot Entry Name NADE_HUMAN
PDB IDs Not Available
GenBank Gene ID AB091316
GeneCard ID NADSYN1
GenAtlas ID NADSYN1
HGNC ID HGNC:29832
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  4. Hara N, Yamada K, Terashima M, Osago H, Shimoyama M, Tsuchiya M: Molecular identification of human glutamine- and ammonia-dependent NAD synthetases. Carbon-nitrogen hydrolase domain confers glutamine dependency. J Biol Chem. 2003 Mar 28;278(13):10914-21. Epub 2003 Jan 23. [PubMed:12547821 ]