You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03274
Secondary Accession Numbers
  • 8849
Name Sodium/glucose cotransporter 2
Synonyms
  1. Low affinity sodium-glucose cotransporter
  2. Na(+)/glucose cotransporter 2
  3. Solute carrier family 5 member 2
Gene Name SLC5A2
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
carbohydrate metabolic process
Cellular Component
plasma membrane
brush border membrane
integral to membrane
Component
membrane
cell part
Function
transporter activity
Molecular Function
low-affinity glucose:sodium symporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 16
Locus 16p11.2
SNPs SLC5A2
Gene Sequence
>2019 bp
ATGGAGGAGCACACAGAGGCAGGCTCGGCACCAGAGATGGGGGCCCAGAAGGCCCTGATT
GACAATCCTGCTGACATCCTAGTCATTGCTGCATATTTCCTGCTGGTCATTGGCGTTGGC
TTGTGGTCCATGTGCAGAACCAACAGAGGCACTGTGGGCGGCTACTTCCTGGCAGGACGC
AGCATGGTGTGGTGGCCGGTTGGGGCCTCTCTCTTCGCCAGCAACATCGGCAGTGGCCAC
TTTGTGGGCCTGGCAGGGACTGGCGCTGCAAGTGGCTTGGCTGTTGCTGGATTCGAGTGG
AATGCGCTCTTCGTGGTGCTGCTACTGGGCTGGCTGTTTGCACCCGTGTACCTGACAGCG
GGGGTCATCACGATGCCACAGTACCTGCGCAAGCGCTTCGGCGGCCGCCGCATCCGCCTC
TACCTGTCTGTGCTCTCCCTTTTCCTGTACATCTTCACCAAGATCTCAGTGGACATGTTC
TCCGGAGCTGTATTCATCCAGCAGGCTCTGGGCTGGAACATCTATGCCTCCGTCATCGCG
CTTCTGGGCATCACCATGATTTACACGGTGACAGGAGGGCTGGCCGCGCTGATGTACACG
GACACGGTACAGACCTTCGTCATTCTGGGGGGCGCCTGCATCCTCATGGGTTACGCCTTC
CACGAGGTGGGCGGGTATTCGGGTCTCTTCGACAAATACCTGGGAGCAGCGACTTCGCTG
ACGGTGTCCGAGGATCCAGCCGTGGGAAACATCTCCAGCTTCTGCTATCGACCCCGGCCC
GACTCCTACCACCTGCTCCGGCACCCCGTGACCGGGGATCTGCCGTGGCCCGCGCTGCTC
CTCGGACTCACAATCGTCTCGGGCTGGTACTGGTGCAGCGACCAGGTCATCGTGCAGCGC
TGCCTGGCCGGGAAGAGCCTGACCCACATCAAGGCGGGCTGCATCCTGTGTGGGTACCTG
AAGCTGACGCCCATGTTTCTCATGGTCATGCCAGGCATGATCAGCCGCATTCTGTACCCA
GACGAGGTGGCGTGCGTGGTGCCTGAGGTGTGCAGGCGCGTGTGCGGCACGGAGGTGGGC
TGCTCCAACATCGCCTACCCGCGGCTCGTCGTGAAGCTCATGCCCAACGGTCTGCGCGGA
CTCATGCTGGCGGTCATGCTGGCCGCGCTCATGTCCTCGCTGGCCTCCATCTTCAACAGC
AGCAGCACGCTCTTCACCATGGACATCTACACGCGCCTGCGGCCACGCGCCGGCGACCGC
GAGCTGCTGCTGGTGGGACGGCTCTGGGTGGTGTTCATCGTGGTAGTGTCGGTGGCCTGG
CTTCCCGTGGTGCAGGCGGCACAGGGCGGGCAGCTCTTCGATTACATCCAGGCAGTCTCT
AGCTACCTGGCACCGCCCGTGTCCGCCGTCTTCGTGCTGGCGCTCTTCGTGCCGCGCGTT
AATGAGCAGGGCGCCTTCTGGGGACTCATCGGGGGCCTGCTGATGGGCCTGGCACGCCTG
ATTCCCGAGTTCTCCTTCGGCTCGGGCAGCTGTGTGCAGCCCTCGGCGTGCCCAGCTTTC
CTCTGCGGCGTGCACTACCTCTACTTCGCCATTGTGCTGTTCTTCTGCTCTGGCCTCCTC
ACCCTCACGGTCTCCCTGTGCACCGCGCCCATCCCCAGAAAGCACCTCCACCGCCTGGTC
TTCAGTCTCCGGCATAGCAAGGAGGAACGGGAGGACCTGGATGCTGATGAGCAGCAAGGC
TCCTCACTCCCTGTACAGAATGGGTGCCCAGAGAGTGCCATGGAGATGAATGAGCCCCAG
GCCCCGGCACCAAGCCTCTTCCGCCAGTGCCTGCTCTGGTTTTGTGGAATGAGCAGAGGT
GGGGTGGGCAGTCCTCCGCCCCTTACCCAGGAGGAGGCAGCGGCAGCAGCCAGGCGGCTG
GAGGACATCAGCGAGGACCCGAGCTGGGCCCGTGTGGTCAACCTCAATGCCCTGCTCATG
ATGGCAGTGGCCGTGTTCCTCTGGGGCTTCTATGCCTAA
Protein Properties
Number of Residues 672
Molecular Weight 72895.995
Theoretical pI 7.479
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium/glucose cotransporter 2
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA
GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA
LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL
TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR
CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG
CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV
NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL
TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ
APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM
MAVAVFLWGFYA
GenBank ID Protein 338053
UniProtKB/Swiss-Prot ID P31639
UniProtKB/Swiss-Prot Entry Name SC5A2_HUMAN
PDB IDs Not Available
GenBank Gene ID M95549
GeneCard ID SLC5A2
GenAtlas ID SLC5A2
HGNC ID HGNC:11037
References
General References
  1. Wells RG, Pajor AM, Kanai Y, Turk E, Wright EM, Hediger MA: Cloning of a human kidney cDNA with similarity to the sodium-glucose cotransporter. Am J Physiol. 1992 Sep;263(3 Pt 2):F459-65. [PubMed:1415574 ]
  2. Calado J, Soto K, Clemente C, Correia P, Rueff J: Novel compound heterozygous mutations in SLC5A2 are responsible for autosomal recessive renal glucosuria. Hum Genet. 2004 Feb;114(3):314-6. Epub 2003 Nov 12. [PubMed:14614622 ]