You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03337
Secondary Accession Numbers
  • 8925
Name Sodium-coupled neutral amino acid transporter 1
Synonyms
  1. Amino acid transporter A1
  2. N-system amino acid transporter 2
  3. Solute carrier family 38 member 1
  4. System A amino acid transporter 1
  5. System N amino acid transporter 1
Gene Name SLC38A1
Protein Type Unknown
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of glutamine and sodium ions with a stoichiometry of 1:1. May also transport small zwitterionic and aliphatic amino acids with a lower affinity. May supply glutamatergic and GABAergic neurons with glutamine which is required for the synthesis of the neurotransmitters glutamate and GABA
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 12q13.11
SNPs SLC38A1
Gene Sequence
>1464 bp
ATGATGCATTTCAAAAGTGGACTCGAATTAACTGAGTTGCAAAACATGACAGTGCCCGAG
GATGATAACATTAGCAATGACTCCAATGATTTCACCGAAGTAGAAAATGGTCAGATAAAT
AGCAAGTTTATTTCTGATCGTGAAAGTAGAAGAAGTCTCACAAACAGCCATTTGGAAAAA
AAGAAGTGTGATGAGTATATTCCAGGTACAACCTCCTTAGGCATGTCTGTTTTTAACCTA
AGCAACGCCATTATGGGCAGTGGGATTTTGGGACTCGCCTTTGCCCTGGCAAACACTGGA
ATCCTACTTTTTCTGGTACTTTTGACTTCAGTGACATTGCTGTCTATATATTCAATAAAC
CTCCTATTGATCTGTTCAAAAGAAACAGGCTGCATGGTGTATGAAAAGCTGGGGGAACAA
GTCTTTGGCACCACAGGGAAGTTCGTAATCTTTGGAGCCACCTCTCTACAGAACACTGGA
GCAATGCTGAGCTACCTCTTCATCGTAAAAAATGAACTACCCTCTGCCATAAAGTTTCTA
ATGGGAAAGGAAGAGACATTTTCAGCCTGGTACGTGGATGGCCGCGTTCTGGTGGTGATA
GTTACCTTTGGCATAATTCTCCCTCTGTGTCTCTTGAAGAACTTAGGGTATCTTGGCTAT
ACTAGTGGATTTTCCTTGAGCTGTATGGTTTTTTTCCTAATTGTGGTTATTTACAAGAAA
TTTCAAATTCCCTGCATTGTTCCAGAGCTAAATTCAACAATAAGTGCTAATTCAACAAAT
GCTGACACGTGTACGCCAAAATATGTTACCTTCAATTCAAAGACCGTGTATGCTTTACCC
ACCATTGCATTTGCATTTGTTTGCCACCCGTCAGTCCTGCCAATTTACAGTGAGCTTAAA
GACCGATCACAGAAAAAAATGCAGATGGTTTCAAACATCTCCTTTTTCGCCATGTTTGTT
ATGTACTTCTTGACTGCCATTTTTGGCTACTTGACATTCTATGACAACGTGCAGTCCGAC
CTCCTTCACAAATATCAGAGTAAAGATGACATTCTCATCCTGACAGTGCGGCTGGCTGTC
ATTGTTGCTGTGATCCTCACAGTGCCGGTGTTATTTTTCACGGTTCGTTCATCTTTATTT
GAACTGGCTAAGAAAACAAAGTTTAATTTATGTCGTCATACCGTGGTTACCTGCATACTC
TTGGTTGTTATCAACTTGTTGGTGATCTTCATACCCTCCATGAAGGATATTTTTGGAGTC
GTAGGAGTTACATCTGCTAACATGCTTATTTTCATTCTTCCTTCATCTCTTTATTTAAAA
ATCACAGACCAGGATGGAGATAAAGGAACTCAAAGAATTTGGGCTGCCCTTTTCTTGGGC
CTGGGGGTGTTGTTCTCCTTGGTCAGCATTCCCTTGGTCATCTATGACTGGGCCTGCTCA
TCGAGTAGTGACGAAGGCCACTGA
Protein Properties
Number of Residues 487
Molecular Weight 54047.0
Theoretical pI 7.03
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 75-97
  • 113-133
  • 148-168
  • 189-211
  • 217-237
  • 276-296
  • 313-333
  • 351-371
  • 394-414
  • 417-437
  • 453-473
Protein Sequence
>Sodium-coupled neutral amino acid transporter 1
MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEK
KKCDEYIPGTTSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSIN
LLLICSKETGCMVYEKLGEQVFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFL
MGKEETFSAWYVDGRVLVVIVTFGIILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKK
FQIPCIVPELNSTISANSTNADTCTPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYSELK
DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDDILILTVRLAV
IVAVILTVPVLFFTVRSSLFELAKKTKFNLCRHTVVTCILLVVINLLVIFIPSMKDIFGV
VGVTSANMLIFILPSSLYLKITDQDGDKGTQRIWAALFLGLGVLFSLVSIPLVIYDWACS
SSSDEGH
GenBank ID Protein 117168277
UniProtKB/Swiss-Prot ID Q9H2H9
UniProtKB/Swiss-Prot Entry Name S38A1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001077484.1
GeneCard ID SLC38A1
GenAtlas ID SLC38A1
HGNC ID HGNC:13447
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. [PubMed:16303743 ]
  8. Desforges M, Lacey HA, Glazier JD, Greenwood SL, Mynett KJ, Speake PF, Sibley CP: SNAT4 isoform of system A amino acid transporter is expressed in human placenta. Am J Physiol Cell Physiol. 2006 Jan;290(1):C305-12. Epub 2005 Sep 7. [PubMed:16148032 ]
  9. Wang H, Huang W, Sugawara M, Devoe LD, Leibach FH, Prasad PD, Ganapathy V: Cloning and functional expression of ATA1, a subtype of amino acid transporter A, from human placenta. Biochem Biophys Res Commun. 2000 Jul 14;273(3):1175-9. [PubMed:10891391 ]
  10. Nelson DM, Smith SD, Furesz TC, Sadovsky Y, Ganapathy V, Parvin CA, Smith CH: Hypoxia reduces expression and function of system A amino acid transporters in cultured term human trophoblasts. Am J Physiol Cell Physiol. 2003 Feb;284(2):C310-5. Epub 2002 Sep 25. [PubMed:12388062 ]
  11. Melone M, Quagliano F, Barbaresi P, Varoqui H, Erickson JD, Conti F: Localization of the glutamine transporter SNAT1 in rat cerebral cortex and neighboring structures, with a note on its localization in human cortex. Cereb Cortex. 2004 May;14(5):562-74. Epub 2004 Mar 28. [PubMed:15054072 ]
  12. Ogura M, Nakamichi N, Takano K, Oikawa H, Kambe Y, Ohno Y, Taniura H, Yoneda Y: Functional expression of A glutamine transporter responsive to down-regulation by lipopolysaccharide through reduced promoter activity in cultured rat neocortical astrocytes. J Neurosci Res. 2006 Jun;83(8):1447-60. [PubMed:16583402 ]