Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03349
Secondary Accession Numbers
  • 8937
Name Choline/ethanolaminephosphotransferase 1
Synonyms
  1. hCEPT1
Gene Name CEPT1
Protein Type Unknown
Biological Properties
General Function Involved in phosphotransferase activity, for other substituted phosphate groups
Specific Function Catalyzes both phosphatidylcholine and phosphatidylethanolamine biosynthesis from CDP-choline and CDP-ethanolamine, respectively. Involved in protein-dependent process of phospholipid transport to distribute phosphatidyl choline to the lumenal surface. Has a higher cholinephosphotransferase activity than ethanolaminephosphotransferase activity.
Pathways
  • Ether lipid metabolism
  • Glycerophospholipid metabolism
  • Phosphatidylcholine Biosynthesis
  • phosphatidylcholine biosynthesis
  • Phosphatidylcholine Biosynthesis PC(11D3/11D3)
  • Phosphatidylcholine Biosynthesis PC(11D3/11D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/11M3)
  • Phosphatidylcholine Biosynthesis PC(11D3/11M5)
  • Phosphatidylcholine Biosynthesis PC(11D3/13D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/13M5)
  • Phosphatidylcholine Biosynthesis PC(11D3/9D3)
  • Phosphatidylcholine Biosynthesis PC(11D3/9D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/9M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(11D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(11D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(11D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/11D3)
  • Phosphatidylcholine Biosynthesis PC(11M3/11D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/11M3)
  • Phosphatidylcholine Biosynthesis PC(11M3/11M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/13D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/13M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/9D3)
  • Phosphatidylcholine Biosynthesis PC(11M3/9D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/9M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(11M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(11M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(11M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/9M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(13D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(13D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(13D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(13M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(13M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(13M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/9M5)
  • Phosphatidylcholine Biosynthesis PC(14:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(9D3/11D3)
  • Phosphatidylcholine Biosynthesis PC(9D3/11D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/11M3)
  • Phosphatidylcholine Biosynthesis PC(9D3/11M5)
  • Phosphatidylcholine Biosynthesis PC(9D3/13D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/13M5)
  • Phosphatidylcholine Biosynthesis PC(9D3/9D3)
  • Phosphatidylcholine Biosynthesis PC(9D3/9D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/9M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(9D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(9D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(9D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(9M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(9M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(9M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/9M5)
  • Phosphatidylethanolamine Biosynthesis
  • phosphatidylethanolamine biosynthesis
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D3/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11D5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M3/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(11M5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(13D5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(13M5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D3/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(9D5/9M5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11D3)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11D5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11M3)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/11M5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/13D5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/13M5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/9D3)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/9D5)
  • Phosphatidylethanolamine Biosynthesis PE(9M5/9M5)
  • Plasmalogen Synthesis
Reactions
CDP-Ethanolamine + 1,2-diacylglycerol → Cytidine monophosphate + a phosphatidylethanolamine details
Citicoline + 1,2-diacylglycerol → Cytidine monophosphate + a phosphatidylcholine details
Citicoline + 1,2-Diacyl-sn-glycerol → Cytidine monophosphate + Phosphatidylcholine details
CDP-Ethanolamine + 1,2-Diacyl-sn-glycerol → Cytidine monophosphate + Phosphatidylethanolamine details
Citicoline + 1-Alkyl-2-acetyl-sn-glycerol → Cytidine monophosphate + 2-Acetyl-1-alkyl-sn-glycero-3-phosphocholine details
CMP-2-aminoethylphosphonate + Diacylglycerol → Cytidine monophosphate + Diacylglyceryl-2-aminoethylphosphonate details
CMP-N-trimethyl-2-aminoethylphosphonate + Diacylglycerol → Cytidine monophosphate + Diacylglyceryl-N-trimethyl-2-aminoethylphosphonate details
CDP-Ethanolamine + 1-Alkyl-2-acylglycerol → Cytidine monophosphate + 1-Alkyl-2-acylglycerophosphoethanolamine details
O-1-Alk-1-enyl-2-acyl-sn-glycero-3-phosphoethanolamine + Cytidine monophosphate → 1-Alkenyl-2-acylglycerol + CDP-Ethanolamine details
1-Alkyl-2-acylglycerol + Citicoline → 1-Radyl-2-acyl-sn-glycero-3-phosphocholine + Cytidine monophosphate details
GO Classification
Biological Process
phosphatidylethanolamine biosynthetic process
Cellular Component
endoplasmic reticulum membrane
nuclear membrane
integral to membrane
Component
membrane
cell part
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
phosphotransferase activity, for other substituted phosphate groups
Molecular Function
metal ion binding
diacylglycerol cholinephosphotransferase activity
ethanolaminephosphotransferase activity
Process
metabolic process
phospholipid biosynthetic process
organophosphate metabolic process
phospholipid metabolic process
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
  3. Multi-pass membrane protein
  4. Nucleus membrane
Gene Properties
Chromosome Location 1
Locus 1p13.3
SNPs CEPT1
Gene Sequence
>1251 bp
ATGAGTGGGCATCGATCAACAAGGAAAAGATGTGGAGATTCTCACCCGGAGTCCCCAGTG
GGCTTCGGGCATATGAGTACTACAGGATGTGTATTAAATAAATTGTTTCAGTTACCAACA
CCACCATTGTCAAGACACCAACTAAAGCGGCTAGAAGAACACAGATATCAAAGTGCTGGA
CGGTCCCTGCTTGAGCCCTTAATGCAAGGGTATTGGGAATGGCTCGTTAGAAGAGTTCCC
TCCTGGATTGCCCCAAATCTCATCACCATCATTGGACTGTCAATAAACATCTGTACAACT
ATTTTATTAGTCTTCTACTGCCCTACAGCTACAGAGCAGGCACCTCTGTGGGCATATATT
GCTTGTGCCTGTGGCCTTTTCATTTACCAGTCTTTGGATGCTATTGATGGGAAACAGGCA
AGAAGAACCAATAGTAGTTCTCCTCTGGGAGAACTTTTTGATCATGGCTGTGATTCACTA
TCAACAGTTTTTGTGGTTCTTGGAACTTGTATTGCAGTGCAGCTGGGGACAAACCCTGAT
TGGATGTTTTTTTGTTGTTTTGCGGGGACATTTATGTTCTATTGTGCGCACTGGCAAACG
TATGTTTCTGGAACATTGCGATTTGGAATAATTGATGTGACTGAAGTGCAAATCTTCATA
ATAATCATGCATTTGCTGGCAGTGATTGGAGGACCACCTTTTTGGCAATCTATGATTCCA
GTGCTGAATATTCAAATGAAAATTTTTCCTGCACTTTGTACTGTAGCAGGGACCATATTT
TCCTGTACAAATTACTTCCGTGTAATCTTCACAGGTGGTGTTGGCAAAAATGGATCAACA
ATAGCAGGAACAAGTGTCCTTTCTCCTTTTCTCCATATTGGATCAGTGATTACATTAGCT
GCAATGATCTACAAGAAATCTGCAGTTCAGCTTTTTGAAAAGCATCCCTGTCTTTATATA
CTGACATTTGGTTTTGTGTCTGCTAAAATCACTAATAAGCTTGTGGTTGCACACATGACG
AAAAGTGAAATGCATTTGCATGACACAGCATTCATAGGTCCGGCACTTTTGTTTCTGGAC
CAGTATTTTAACAGCTTTATTGATGAATATATTGTACTTTGGATTGCCCTGGTTTTCTCT
TTCTTTGATTTGATCCGCTACTGTGTCAGTGTTTGCAATCAGATTGCGTCTCACCTGCAC
ATACATGTCTTCAGAATCAAGGTCTCTACAGCTCATTCTAATCATCATTAA
Protein Properties
Number of Residues 416
Molecular Weight 46553.135
Theoretical pI 8.201
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Choline/ethanolaminephosphotransferase 1
MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAG
RSLLEPLMQGYWEWLVRRVPSWIAPNLITIIGLSINICTTILLVFYCPTATEQAPLWAYI
ACACGLFIYQSLDAIDGKQARRTNSSSPLGELFDHGCDSLSTVFVVLGTCIAVQLGTNPD
WMFFCCFAGTFMFYCAHWQTYVSGTLRFGIIDVTEVQIFIIIMHLLAVIGGPPFWQSMIP
VLNIQMKIFPALCTVAGTIFSCTNYFRVIFTGGVGKNGSTIAGTSVLSPFLHIGSVITLA
AMIYKKSAVQLFEKHPCLYILTFGFVSAKITNKLVVAHMTKSEMHLHDTAFIGPALLFLD
QYFNSFIDEYIVLWIALVFSFFDLIRYCVSVCNQIASHLHIHVFRIKVSTAHSNHH
GenBank ID Protein 4584877
UniProtKB/Swiss-Prot ID Q9Y6K0
UniProtKB/Swiss-Prot Entry Name CEPT1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF068302
GeneCard ID CEPT1
GenAtlas ID CEPT1
HGNC ID HGNC:24289
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Henneberry AL, Wistow G, McMaster CR: Cloning, genomic organization, and characterization of a human cholinephosphotransferase. J Biol Chem. 2000 Sep 22;275(38):29808-15. [PubMed:10893425 ]
  6. Henneberry AL, Wright MM, McMaster CR: The major sites of cellular phospholipid synthesis and molecular determinants of Fatty Acid and lipid head group specificity. Mol Biol Cell. 2002 Sep;13(9):3148-61. [PubMed:12221122 ]
  7. Henneberry AL, McMaster CR: Cloning and expression of a human choline/ethanolaminephosphotransferase: synthesis of phosphatidylcholine and phosphatidylethanolamine. Biochem J. 1999 Apr 15;339 ( Pt 2):291-8. [PubMed:10191259 ]
  8. Wright MM, McMaster CR: PC and PE synthesis: mixed micellar analysis of the cholinephosphotransferase and ethanolaminephosphotransferase activities of human choline/ethanolamine phosphotransferase 1 (CEPT1). Lipids. 2002 Jul;37(7):663-72. [PubMed:12216837 ]