You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03630
Secondary Accession Numbers
  • 9218
Name Vesicular inhibitory amino acid transporter
Synonyms
  1. GABA and glycine transporter
  2. Solute carrier family 32 member 1
  3. Vesicular GABA transporter
  4. hVIAAT
Gene Name SLC32A1
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Involved in the uptake of GABA and glycine into the synaptic vesicles
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Multi-pass membrane protein
  2. Cytoplasmic vesicle membrane
Gene Properties
Chromosome Location Chromosome:2
Locus 20q11.23
SNPs SLC32A1
Gene Sequence
>1578 bp
ATGGCCACCTTGCTCCGCAGCAAGCTGTCCAACGTGGCCACGTCCGTGTCCAACAAGTCC
CAGGCCAAGATGAGCGGCATGTTCGCCAGGATGGGTTTTCAGGCGGCCACGGATGAGGAG
GCGGTGGGCTTCGCGCATTGCGACGACCTCGACTTTGAGCACCGCCAGGGCCTGCAGATG
GACATCCTGAAAGCCGAGGGAGAGCCCTGCGGGGACGAGGGCGCTGAAGCGCCCGTCGAG
GGAGACATCCATTATCAGCGAGGCAGCGGAGCTCCTCTGCCGCCCTCCGGCTCCAAGGAC
CAGGTGGGAGGTGGTGGCGAATTCGGGGGCCACGACAAGCCCAAAATCACGGCGTGGGAG
GCAGGCTGGAACGTGACCAACGCCATCCAGGGCATGTTCGTGCTGGGCCTACCCTACGCC
ATCCTGCACGGCGGCTACCTGGGGTTGTTTCTCATCATCTTCGCCGCCGTTGTGTGCTGC
TACACCGGCAAGATCCTCATCGCGTGCCTGTACGAGGAGAATGAAGACGGCGAGGTGGTG
CGCGTGCGGGACTCGTACGTGGCCATAGCCAACGCCTGCTGCGCCCCGCGCTTCCCAACG
CTGGGCGGCCGAGTGGTGAACGTAGCGCAGATCATCGAGCTGGTGATGACGTGCATCCTG
TACGTGGTGGTGAGTGGCAACCTCATGTACAACAGCTTCCCGGGGCTGCCCGTGTCGCAG
AAGTCCTGGTCCATTATCGCCACGGCCGTGCTGCTGCCTTGCGCCTTCCTTAAGAACCTC
AAGGCCGTGTCCAAGTTCAGTCTGCTGTGCACTCTGGCCCACTTCGTCATCAATATCCTG
GTCATAGCCTACTGTCTATCGCGGGCGCGCGACTGGGCCTGGGAGAAGGTCAAGTTCTAC
ATCGACGTCAAGAAGTTCCCCATCTCCATTGGCATCATCGTGTTCAGCTACACGTCTCAG
ATCTTCCTGCCTTCGCTGGAGGGCAATATGCAGCAGCCCAGCGAGTTCCACTGCATGATG
AACTGGACGCACATCGCAGCCTGCGTGCTCAAGGGCCTCTTCGCGCTCGTCGCCTACCTC
ACCTGGGCCGACGAGACCAAGGAGGTCATCACGGATAACCTGCCCGGCTCCATCCGCGCC
GTGGTCAACATCTTTCTGGTGGCCAAGGCGCTGTTGTCCTATCCTCTGCCATTCTTTGCC
GCTGTCGAGGTGCTGGAGAAGTCGCTCTTCCAGGAAGGCAGCCGCGCCTTTTTCCCGGCC
TGCTACAGCGGCGACGGGCGCCTGAAGTCCTGGGGGCTGACGCTGCGCTGCGCGCTCGTC
GTCTTCACGCTGCTCATGGCCATTTATGTGCCGCACTTCGCGCTGCTCATGGGCCTCACC
GGCAGCCTCACGGGCGCCGGCCTCTGTTTCTTGCTGCCCAGCCTCTTTCACCTGCGCCTG
CTCTGGCGCAAGCTGCTGTGGCACCAAGTCTTCTTCGACGTCGCCATCTTCGTCATCGGC
GGCATCTGCAGCGTGTCCGGCTTCGTGCACTCCCTCGAGGGCCTCATCGAAGCCTACCGA
ACCAACGCGGAGGACTAG
Protein Properties
Number of Residues 525
Molecular Weight 57414.6
Theoretical pI 6.63
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 134-154
  • 205-225
  • 243-263
  • 266-286
  • 306-326
  • 342-362
  • 384-404
  • 439-459
  • 462-482
  • 490-510
Protein Sequence
>Vesicular inhibitory amino acid transporter
MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQM
DILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE
AGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVV
RVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQ
KSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFY
IDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYL
TWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPA
CYSGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRL
LWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H598
UniProtKB/Swiss-Prot Entry Name VIAAT_HUMAN
PDB IDs Not Available
GenBank Gene ID AY044836
GeneCard ID SLC32A1
GenAtlas ID SLC32A1
HGNC ID HGNC:11018
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  4. Chessler SD, Simonson WT, Sweet IR, Hammerle LP: Expression of the vesicular inhibitory amino acid transporter in pancreatic islet cells: distribution of the transporter within rat islets. Diabetes. 2002 Jun;51(6):1763-71. [PubMed:12031963 ]
  5. Jellali A, Stussi-Garaud C, Gasnier B, Rendon A, Sahel JA, Dreyfus H, Picaud S: Cellular localization of the vesicular inhibitory amino acid transporter in the mouse and human retina. J Comp Neurol. 2002 Jul 15;449(1):76-87. [PubMed:12115694 ]