You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03831
Secondary Accession Numbers
  • 9419
Name Hydroxyacid-oxoacid transhydrogenase, mitochondrial
Synonyms
  1. ADHFe1
  2. Alcohol dehydrogenase iron-containing protein 1
  3. Fe-containing alcohol dehydrogenase
  4. HOT
Gene Name ADHFE1
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Catalyzes the cofactor-independent reversible oxidation of gamma-hydroxybutyrate (GHB) to succinic semialdehyde (SSA) coupled to reduction of 2-ketoglutarate (2-KG) to D-2-hydroxyglutarate (D-2-HG). D,L-3-hydroxyisobutyrate and L-3-hydroxybutyrate (L-3-OHB) are also substrates for HOT with 10-fold lower activities.
Pathways Not Available
Reactions
(S)-3-Hydroxybutyric acid + Oxoglutaric acid → Acetoacetic acid + D-2-Hydroxyglutaric acid details
4-Hydroxybutyric acid + Oxoglutaric acid → Succinic acid semialdehyde + D-2-Hydroxyglutaric acid details
GO Classification
Biological Process
2-oxoglutarate metabolic process
molecular hydrogen transport
Cellular Component
mitochondrial matrix
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
oxidoreductase activity
Molecular Function
metal ion binding
hydroxyacid-oxoacid transhydrogenase activity
Process
metabolic process
oxidation reduction
Cellular Location
  1. Mitochondrion
Gene Properties
Chromosome Location 8
Locus 8q13.1
SNPs ADHFE1
Gene Sequence
>1404 bp
ATGGCCGCTGCCGCCCGAGCCCGGGTCGCGTACTTGCTGAGGCAACTGCAACGCGCAGCG
TGCCAGTGCCCAACTCATTCTCATACTTACTCCCAAGCCCCTGGACTTTCACCTTCTGGG
AAAACAACAGATTATGCCTTTGAGATGGCTGTTTCAAATATTAGATATGGAGCAGCAGTT
ACAAAGGAAGTAGGAATGGACCTAAAAAACATGGGTGCTAAAAATGTGTGCTTGATGACA
GACAAGAACCTCTCCAAGCTCCCTCCTGTGCAAGTAGCTATGGATTCCCTAGTGAAGAAT
GGCATCCCCTTTACGGTTTATGATAATGTGAGAGTGGAACCAACGGATTCAAGCTTCATG
GAAGCTATTGAGTTTGCCCAAAAGGGAGCTTTTGATGCCTATGTTGCTGTCGGTGGTGGC
TCTACCATGGACACCTGTAAGGCTGCTAATCTGTATGCATCCAGCCCTCATTCTGATTTC
CTAGATTATGTCAGTGCCCCCATTGGCAAGGGAAAGCCTGTGTCTGTGCCTCTTAAGCCT
CTGATTGCAGTGCCAACTACCTCAGGAACCGGGAGTGAAACTACTGGGGTTGCCATTTTT
GACTATGAACACTTGAAAGTAAAAATTGGTATCACTTCGAGAGCCATCAAACCCACACTG
GGACTGATTGATCCTCTGCACACCCTCCACATGCCTGCCCGAGTGGTCGCCAACAGTGGC
TTTGATGTGCTTTGCCATGCCCTGGAGTCATACACCACCCTGCCCTACCACCTGCGGAGC
CCCTGCCCTTCAAATCCCATCACACGGCCTGCGTACCAGGGCAGCAACCCAATCAGTGAC
ATTTGGGCTATCCACGCGCTGCGGATCGTGGCTAAGTATCTGAAGAGGGCCGTCAGAAAT
CCCGATGATCTTGAAGCAAGGTCTCATATGCACTTGGCAAGTGCTTTTGCTGGCATCGGC
TTTGGAAATGCTGGTGTTCATCTGTGCCATGGAATGTCTTACCCAATTTCAGGTTTAGTG
AAGATGTATAAAGCAAAGGATTACAATGTGGATCACCCACTGGTGCCCCATGGCCTTTCT
GTGGTGCTCACGTCCCCAGCGGTGTTCACTTTCACGGCCCAGATGTTTCCAGAGCGACAC
CTGGAGATGGCAGAAATATTGGGAGCCGACACCCGCACTGCCAGGATCCAAGATGCAGGG
CTGGTGTTGGCAGACACGCTCCGGAAATTCTTATTCGATCTGGATGTTGATGATGGCCTA
GCAGCTGTTGGTTACTCCAAAGCTGATATCCCCGCACTAGTGAAAGGAACGCTGCCCCAG
GAAAGGGTCACCAAGCTTGCACCCTGTCCCCAGTCAGAAGAGGATCTGGCTGCTCTGTTT
GAAGCTTCAATGAAACTGTATTAA
Protein Properties
Number of Residues 467
Molecular Weight 50307.42
Theoretical pI 7.762
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Hydroxyacid-oxoacid transhydrogenase, mitochondrial
MAAAARARVAYLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGAAV
TKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFM
EAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKP
LIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSG
FDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVRN
PDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKMYKAKDYNVDHPLVPHGLS
VVLTSPAVFTFTAQMFPERHLEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGL
AAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMKLY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IWW8
UniProtKB/Swiss-Prot Entry Name HOT_HUMAN
PDB IDs Not Available
GenBank Gene ID AY033237
GeneCard ID ADHFE1
GenAtlas ID ADHFE1
HGNC ID HGNC:16354
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Yamada S, Ohira M, Horie H, Ando K, Takayasu H, Suzuki Y, Sugano S, Hirata T, Goto T, Matsunaga T, Hiyama E, Hayashi Y, Ando H, Suita S, Kaneko M, Sasaki F, Hashizume K, Ohnuma N, Nakagawara A: Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas. Oncogene. 2004 Aug 5;23(35):5901-11. [PubMed:15221005 ]
  5. Deng Y, Wang Z, Gu S, Ji C, Ying K, Xie Y, Mao Y: Cloning and characterization of a novel human alcohol dehydrogenase gene (ADHFe1). DNA Seq. 2002 Oct;13(5):301-6. [PubMed:12592711 ]
  6. Struys EA, Verhoeven NM, Ten Brink HJ, Wickenhagen WV, Gibson KM, Jakobs C: Kinetic characterization of human hydroxyacid-oxoacid transhydrogenase: relevance to D-2-hydroxyglutaric and gamma-hydroxybutyric acidurias. J Inherit Metab Dis. 2005;28(6):921-30. [PubMed:16435184 ]