You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03946
Secondary Accession Numbers
  • 9534
Name Vesicular glutamate transporter 2
Synonyms
  1. Differentiation-associated BNPI
  2. Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter
  3. Solute carrier family 17 member 6
  4. VGluT2
Gene Name SLC17A6
Protein Type Unknown
Biological Properties
General Function Involved in transmembrane transport
Specific Function Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate.
Pathways
  • Glutamatergic synapse
  • Nicotine addiction
  • Retrograde endocannabinoid signaling
  • Synaptic vesicle cycle
Reactions Not Available
GO Classification
Biological Process
ion transport
sodium ion transport
neurotransmitter uptake
transmembrane transport
Cellular Component
cell junction
early endosome
neuron projection
integral to membrane
synaptic vesicle membrane
Molecular Function
symporter activity
L-glutamate transmembrane transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Cytoplasmic vesicle
  2. Membrane
  3. Multi-pass membrane protein (Potential)
  4. secretory vesicle
  5. Cell junction
  6. synapse
  7. synaptosome
  8. synaptic vesicle membrane
Gene Properties
Chromosome Location 11
Locus 11p14.3
SNPs SLC17A6
Gene Sequence
>1749 bp
ATGGAATCCGTAAAACAAAGGATTTTGGCCCCAGGAAAAGAGGGGCTAAAGAATTTTGCT
GGAAAATCACTCGGCCAGATCTACAGGGTGCTGGAGAAGAAGCAAGACACCGGGGAGACA
ATCGAGCTGACGGAGGATGGGAAGCCCCTAGAGGTGCCCGAGAGGAAGGCGCCGCTGTGC
GACTGCACGTGCTTCGGCCTGCCCCGCCGCTACATTATCGCCATCATGAGCGGCCTGGGC
TTCTGCATCTCCTTCGGTATCCGCTGCAACCTGGGCGTGGCCATTGTGGACATGGTCAAC
AACAGCACCATCCACCGCGGGGGCAAGGTCATCAAGGAGAAAGCCAAATTCAACTGGGAC
CCGGAAACCGTGGGGATGATCCACGGTTCCTTCTTTTGGGGCTACATCATCACTCAGATT
CCGGGAGGCTACATCGCGTCTCGGCTGGCAGCCAACAGGGTTTTCGGAGCTGCCATACTT
CTTACCTCTACCCTAAATATGCTAATTCCATCAGCAGCCAGAGTGCATTATGGATGTGTC
ATCTTTGTCAGAATACTGCAGGGACTTGTTGAGGGTGTGACCTACCCAGCATGTCATGGG
ATATGGAGCAAATGGGCCCCACCTCTAGAGAGGAGTAGACTGGCAACCACCTCCTTTTGT
GGTTCCTATGCCGGAGCTGTGATTGCAATGCCTTTAGCTGGCATTCTTGTGCAGTACACT
GGCTGGTCTTCAGTGTTTTATGTCTACGGAAGCTTTGGAATGGTCTGGTACATGTTTTGG
CTTTTGGTGTCTTATGAAAGTCCTGCAAAGCATCCTACTATTACAGATGAAGAACGTAGG
TACATAGAAGAAAGCATTGGAGAGAGTGCAAATCTTTTAGGTGCAATGGAAAAATTCAAG
ACTCCATGGAGGAAGTTTTTTACATCCATGCCAGTCTATGCAATAATTGTTGCAAACTTC
TGCAGAAGCTGGACTTTTTATTTATTGCTTATTAGTCAGCCAGCATATTTTGAGGAAGTC
TTTGGATTTGAAATTAGCAAGGTTGGTATGCTATCTGCTGTGCCACACTTAGTAATGACA
ATTATTGTGCCTATTGGGGGACAAATTGCAGATTTTCTAAGAAGCAAGCAGATTCTTTCA
ACTACGACAGTGAGAAAGATCATGAATTGTGGTGGTTTTGGCATGGAAGCCACACTGCTC
CTGGTCGTTGGCTATTCTCATACTAGAGGGGTAGCAATCTCATTCTTGGTACTTGCAGTG
GGATTCAGTGGATTTGCTATATCTGGTTTCAATGTTAACCACTTGGATATCGCTCCAAGA
TATGCCAGTATCTTAATGGGCATTTCGAATGGTGTTGGCACATTGTCAGGAATGGTTTGT
CCTATCATTGTTGGTGCAATGACAAAGAATAAGTCACGTGAAGAGTGGCAGTATGTCTTC
CTGATCGCTGCCCTAGTCCACTATGGTGGAGTTATATTTTATGCAATATTTGCCTCAGGA
GAGAAACAACCCTGGGCAGACCCGGAGGAAACAAGTGAAGAAAAATGTGGATTTATTCAT
GAAGATGAACTCGATGAAGAAACAGGGGACATTACTCAAAATTATATAAATTATGGTACC
ACCAAGTCTTATGGTGCCACAACACAGGCCAATGGAGGTTGGCCTAGTGGTTGGGAAAAG
AAAGAGGAATTTGTACAAGGAGAAGTACAAGACTCACATAGCTATAAGGACCGAGTTGAT
TATTCATAA
Protein Properties
Number of Residues 582
Molecular Weight 64391.935
Theoretical pI 7.044
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Vesicular glutamate transporter 2
MESVKQRILAPGKEGLKNFAGKSLGQIYRVLEKKQDTGETIELTEDGKPLEVPERKAPLC
DCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWD
PETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCV
IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT
GWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFK
TPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMT
IIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVF
LIAALVHYGGVIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGT
TKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS
GenBank ID Protein 7328923
UniProtKB/Swiss-Prot ID Q9P2U8
UniProtKB/Swiss-Prot Entry Name VGLU2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB032435
GeneCard ID SLC17A6
GenAtlas ID SLC17A6
HGNC ID HGNC:16703
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  4. Aihara Y, Mashima H, Onda H, Hisano S, Kasuya H, Hori T, Yamada S, Tomura H, Yamada Y, Inoue I, Kojima I, Takeda J: Molecular cloning of a novel brain-type Na(+)-dependent inorganic phosphate cotransporter. J Neurochem. 2000 Jun;74(6):2622-5. [PubMed:10820226 ]
  5. Takamori S, Rhee JS, Rosenmund C, Jahn R: Identification of differentiation-associated brain-specific phosphate transporter as a second vesicular glutamate transporter (VGLUT2). J Neurosci. 2001 Nov 15;21(22):RC182. [PubMed:11698620 ]