You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03947
Secondary Accession Numbers
  • 9535
Name Vesicular glutamate transporter 1
Synonyms
  1. Brain-specific Na(+)-dependent inorganic phosphate cotransporter
  2. Solute carrier family 17 member 7
  3. VGluT1
Gene Name SLC17A7
Protein Type Unknown
Biological Properties
General Function Involved in transmembrane transport
Specific Function Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate.
Pathways
  • Glutamatergic synapse
  • Nicotine addiction
  • Retrograde endocannabinoid signaling
  • Synaptic vesicle cycle
Reactions Not Available
GO Classification
Biological Process
regulation of excitatory postsynaptic membrane potential
L-glutamate import
sequestering of neurotransmitter
synaptic transmission, glutamatergic
neurotransmitter secretion
glutamate secretion
long-term memory
Cellular Component
plasma membrane
cell junction
excitatory synapse
clathrin-sculpted glutamate transport vesicle membrane
presynaptic active zone
neuron projection
integral to membrane
synaptic vesicle membrane
Molecular Function
inorganic phosphate transmembrane transporter activity
sodium:inorganic phosphate symporter activity
sodium-dependent phosphate transmembrane transporter activity
L-glutamate transmembrane transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Cytoplasmic vesicle
  2. Membrane
  3. Multi-pass membrane protein (Potential)
  4. secretory vesicle
  5. Cell junction
  6. synapse
  7. synaptosome
  8. synaptic vesicle membrane
Gene Properties
Chromosome Location 19
Locus 19q13
SNPs SLC17A7
Gene Sequence
>1683 bp
ATGGAGTTCCGCCAGGAGGAGTTTCGGAAGCTAGCGGGTCGTGCTCTCGGGAAGCTGCAC
CGCCTTCTGGAGAAGCGGCAGGAAGGCGCGGAGACGCTGGAGCTGAGTGCGGATGGGCGC
CCGGTGACCACGCAGACCCGGGACCCGCCGGTGGTGGACTGCACCTGCTTCGGCCTCCCT
CGCCGCTACATTATCGCCATCATGAGTGGTCTGGGCTTCTGCATCAGCTTTGGCATCCGC
TGCAACCTGGGCGTGGCCATCGTCTCCATGGTCAATAACAGCACGACCCACCGCGGGGGC
CACGTGGTGGTGCAGAAAGCCCAGTTCAGCTGGGATCCAGAGACTGTCGGCCTCATACAC
GGCTCCTTTTTCTGGGGCTACATTGTCACTCAGATTCCAGGAGGATTTATCTGTCAAAAA
TTTGCAGCCAACAGAGTTTTCGGCTTTGCTATTGTGGCAACATCCACTCTAAACATGCTG
ATCCCCTCAGCTGCCCGCGTCCACTATGGCTGTGTCATCTTCGTGAGGATCCTGCAGGGG
TTGGTAGAGGGGGTCACATACCCCGCCTGCCATGGGATCTGGAGCAAATGGGCCCCACCC
TTAGAACGGAGTCGCCTGGCGACGACAGCCTTTTGTGGTTCCTATGCTGGGGCGGTGGTC
GCGATGCCCCTCGCCGGGGTCCTTGTGCAGTACTCAGGATGGAGCTCTGTTTTCTACGTC
TACGGCAGCTTCGGGATCTTCTGGTACCTGTTCTGGCTGCTCGTCTCCTACGAGTCCCCC
GCGCTGCACCCCAGCATCTCGGAGGAGGAGCGCAAGTACATCGAGGACGCCATCGGAGAG
AGCGCGAAACTCATGAACCCCCTCACGAAGTTTAGCACTCCCTGGCGGCGCTTCTTCACG
TCTATGCCAGTCTATGCCATCATCGTGGCCAACTTCTGCCGCAGCTGGACGTTCTACCTG
CTGCTCATCTCCCAGCCCGCCTACTTCGAAGAAGTGTTCGGCTTCGAGATCAGCAAGGTA
GGCCTGGTGTCCGCGCTGCCCCACCTGGTCATGACCATCATCGTGCCCATCGGCGGCCAG
ATCGCGGACTTCCTGCGGAGCCGCCGCATCATGTCCACCACCAACGTGCGCAAGTTGATG
AACTGCGGAGGCTTCGGCATGGAAGCCACGCTGCTGTTGGTGGTCGGCTACTCGCACTCC
AAGGGCGTGGCCATCTCCTTCCTGGTCCTAGCCGTGGGCTTCAGCGGCTTCGCCATCTCT
GGGTTCAACGTGAACCACCTGGACATAGCCCCGCGCTACGCCAGCATCCTCATGGGCATC
TCCAACGGCGTGGGCACACTGTCGGGCATGGTGTGCCCCATCATCGTGGGGGCCATGACT
AAGCACAAGACTCGGGAGGAGTGGCAGTACGTGTTCCTAATTGCCTCCCTGGTGCACTAT
GGAGGTGTCATCTTCTACGGGGTCTTTGCTTCTGGAGAGAAGCAGCCGTGGGCAGAGCCT
GAGGAGATGAGCGAGGAGAAGTGTGGCTTCGTTGGCCATGACCAGCTGGCTGGCAGTGAC
GACAGCGAAATGGAGGATGAGGCTGAGCCCCCGGGGGCACCCCCTGCACCCCCGCCCTCC
TATGGGGCCACACACAGCACATTTCAGCCCCCCAGGCCCCCACCCCCTGTCCGGGACTAC
TGA
Protein Properties
Number of Residues 560
Molecular Weight 61612.845
Theoretical pI 7.475
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Vesicular glutamate transporter 1
MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLP
RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIH
GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFT
SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
IADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
GGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPS
YGATHSTFQPPRPPPPVRDY
GenBank ID Protein 7328925
UniProtKB/Swiss-Prot ID Q9P2U7
UniProtKB/Swiss-Prot Entry Name VGLU1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB032436
GeneCard ID SLC17A7
GenAtlas ID SLC17A7
HGNC ID HGNC:16704
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Aihara Y, Mashima H, Onda H, Hisano S, Kasuya H, Hori T, Yamada S, Tomura H, Yamada Y, Inoue I, Kojima I, Takeda J: Molecular cloning of a novel brain-type Na(+)-dependent inorganic phosphate cotransporter. J Neurochem. 2000 Jun;74(6):2622-5. [PubMed:10820226 ]